SecReT4
Protein ID: 187921147
T4SS name [ID]VirB [370]
Gene symbol-
Locus tagBphyt_6502
StrainBurkholderia phytofirmans PsJN
Repliconchromosome 2 [GenBank: NC_010676] [Browse all T4SS(s) in this replicon]
Location [Strand]2791370..2792065 [-]
ProductP-type DNA transfer protein VirB5
Component typeVirB5
UniProt IDB2T8Z3
KEGG IDbpy:Bphyt_6502
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 8.7e-59, Aligned region: 25..208
OmpH [PF03938], Evalue: 1e-05, Aligned region: 11..205
Protein Sequence: 231 a.a.     [Download]
>gi|187921147|ref|YP_001890179.1| P-type DNA transfer protein VirB5 [Burkholderia phytofirmans PsJN]
MKARSKVATSALVLAAVSPVGYAQGIPVFDAQNVAQAIATVAQLEQEVQQEIQIYQSTVGTRGFGALLNN
PVVGNSLPSNWQGVYAAVQNGGYAGLTGSAQALRSASKIYNCEDQAGIDQQVCQRALNKPFQDKAFGQQA
YQSELQELNQVQSLMQQIDVTQDPKGIAELQARIQTETTAVGDEMTKLQLFRMLADTEDRLIEEQQSELV
LSRAGNTVRLQDQMVPASFGN
 
Nucleotide Sequence: 696 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c2792065-2791370 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGAAAGCACGATCGAAGGTAGCTACGTCTGCGCTCGTCTTGGCAGCCGTTTCTCCGGTGGGCTACGCCC
AGGGCATTCCGGTATTCGACGCGCAGAACGTGGCCCAAGCCATTGCGACGGTCGCGCAGCTTGAGCAGGA
GGTGCAGCAGGAGATCCAGATTTACCAGTCGACGGTTGGCACACGGGGCTTCGGTGCGTTGCTGAACAAT
CCGGTGGTGGGAAATTCGCTGCCGTCGAACTGGCAGGGCGTCTATGCGGCGGTACAGAACGGCGGCTACG
CGGGTCTGACTGGAAGCGCGCAGGCGCTGCGTTCAGCCAGTAAGATCTATAACTGTGAAGACCAGGCCGG
CATCGACCAGCAGGTGTGCCAGCGCGCGCTCAACAAGCCGTTCCAGGACAAGGCGTTCGGCCAGCAGGCC
TACCAGTCCGAACTGCAGGAACTGAACCAGGTCCAGAGCCTGATGCAGCAGATCGATGTCACGCAGGATC
CGAAAGGTATTGCGGAACTGCAGGCGCGCATCCAGACCGAAACCACGGCGGTCGGCGACGAGATGACCAA
GCTGCAGCTCTTCCGGATGCTGGCCGATACGGAAGACCGGCTCATCGAGGAGCAGCAGAGCGAACTGGTA
TTGAGCCGCGCGGGCAATACCGTCAGGCTGCAGGACCAGATGGTGCCAGCGTCGTTCGGTAACTGA
 Primer design