SecReT4
Protein ID: 187921148
T4SS name [ID]VirB [370]
Gene symbol-
Locus tagBphyt_6503
StrainBurkholderia phytofirmans PsJN
Repliconchromosome 2 [GenBank: NC_010676] [Browse all T4SS(s) in this replicon]
Location [Strand]2792080..2793240 [-]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeVirB6
UniProt IDB2T8Z4
KEGG IDbpy:Bphyt_6503
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.7e-34, Aligned region: 39..311
Protein Sequence: 386 a.a.     [Download]
>gi|187921148|ref|YP_001890180.1| TrbL/VirB6 plasmid conjugal transfer protein [Burkholderia phytofirmans PsJN]
MSGLFTAVGGTLENGMSTYVTNVSSALSAALVPVVTTAVTIWVIAYGLAIVRGEAHEAVPAFAWRGLKVA
AILAFALGSGIYQQQVVASVSGATSGLAQTIQNASSTTGGGNPGCGSVSGSSVTSASATSIYQTLDCYDQ
QIDLVLDAYSEKATHEGLSPSGLAAAIGDMVCGFVAAVGGSIFLIVLAFEVVMGRMLLDLVLGIGPIFIA
CAAFAPTVRFFEAWTAKVANYALLQVLVAAFLGMALTAFSTELAPFQVTTSPPGANASALVAASQAALEA
ASAWGAALGMFATAIFLAMVGWQLPSVASGLSGGATVSGFGAFVAGVASRRFATVIGQMLTRSGNGPRPG
GTIRDRTGPGGGSGNSSGGAVPAYQRAAHANLGQGS
 
Nucleotide Sequence: 1161 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c2793240-2792080 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGAGCGGCCTCTTTACCGCGGTTGGCGGCACGCTCGAGAACGGCATGTCGACCTACGTGACGAACGTCT
CGTCGGCGCTGTCGGCCGCGCTCGTTCCCGTCGTAACGACGGCTGTGACGATCTGGGTCATCGCCTATGG
TCTGGCGATCGTGCGGGGAGAGGCACACGAAGCCGTACCGGCGTTTGCGTGGCGAGGACTGAAAGTGGCA
GCCATCCTGGCTTTCGCGCTCGGCAGCGGTATCTACCAGCAGCAGGTCGTGGCCTCTGTCAGCGGTGCCA
CGTCCGGCCTGGCACAGACGATCCAGAACGCGTCCAGCACCACGGGCGGTGGCAACCCCGGATGTGGATC
CGTCAGTGGCAGCAGCGTGACATCGGCCAGCGCCACCAGCATCTACCAGACGCTCGACTGCTATGACCAG
CAGATCGATCTCGTTCTGGATGCCTATTCCGAAAAGGCGACCCACGAGGGGCTTAGCCCGAGCGGCCTGG
CTGCCGCCATTGGCGACATGGTGTGCGGGTTCGTGGCGGCGGTCGGCGGTTCGATTTTCCTGATCGTGCT
CGCGTTCGAAGTCGTGATGGGGCGCATGCTGCTCGACCTGGTCCTCGGGATCGGTCCGATTTTCATCGCC
TGTGCTGCCTTTGCGCCGACCGTCCGTTTCTTCGAAGCGTGGACGGCGAAAGTCGCGAACTACGCATTGC
TACAGGTACTGGTGGCCGCTTTCCTGGGGATGGCACTGACGGCCTTCTCGACTGAGCTCGCGCCTTTCCA
GGTAACGACTTCTCCGCCCGGCGCGAATGCGTCTGCTCTCGTGGCGGCCAGTCAGGCTGCGCTCGAAGCT
GCGTCGGCGTGGGGTGCGGCACTCGGCATGTTTGCGACGGCGATTTTTCTGGCGATGGTTGGCTGGCAAT
TGCCATCAGTGGCGTCCGGCCTGTCAGGGGGGGCGACCGTGTCCGGCTTCGGCGCGTTCGTGGCCGGTGT
CGCCTCACGGCGCTTCGCAACCGTGATCGGTCAGATGCTCACCCGCAGCGGGAATGGTCCGCGTCCTGGC
GGCACGATCCGTGACCGGACTGGCCCCGGCGGCGGCTCGGGGAATTCATCGGGCGGCGCGGTGCCAGCTT
ACCAGCGTGCCGCGCACGCCAACCTGGGACAGGGCAGTTGA
 Primer design