SecReT4
Protein ID: 187921149
T4SS name [ID]VirB [370]
Gene symbol-
Locus tagBphyt_6504
StrainBurkholderia phytofirmans PsJN
Repliconchromosome 2 [GenBank: NC_010676] [Browse all T4SS(s) in this replicon]
Location [Strand]2793237..2795702 [-]
Producttype IV secretion/conjugal transfer ATPase, VirB4 family
Component typeVirB4
UniProt IDB2T8Z5
KEGG IDbpy:Bphyt_6504
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 3.7e-49, Aligned region: 189..387
AAA_10 [PF12846], Evalue: 2.3e-25, Aligned region: 450..728
Protein Sequence: 821 a.a.     [Download]
>gi|187921149|ref|YP_001890181.1| type IV secretion/conjugal transfer ATPase, VirB4 family [Burkholderia phytofirmans PsJN]
MRADTRHGAVAHREVAIADHIPYSTHVTDHVIRTREGDYLQIWKLAGIAFEAADPVDILVRHDGFNQLVR
ALPGGHGALWSHRLRRRVSDHFATPYGNRFCQELATRYYASFAGYRMMANELYLTLVYRPNRTKLGRVFS
RAARRTRDDIRRDQQEALKVMDELGAQVESGLKPYDPVALGVYHRPSPFTKRPRRYSSALELLGYLVNAV
WEPEPVPSGVIREALPTSRLFVGVENVEIRMPAMTRYAALLDLKDYPEETEPGMLNGLLYGDFEYIETQS
FTILDKPGAKEALERQRNQLIAGEDVAVSQVEAMDRALNDLINGDFVLGEYHYSLAVLADTPAAVSKHVA
KARTQLADGGFQTTLIDLVADAAWFAQLPGNWRYRPREAKLTSRNFCGLASLHNFATGKRDGNPWGEAIT
IVKTPSGQPLYLNFHVTPEKQDSADEKALANTQIIGQAGAGKTVLELFLLAMATKFGLTAVLYDKDRGTE
IAIRAMGGIYTVFRRGEPTGLNPFQMTPDESVLDFWERLVRKLVDTGVPLSAKDELDISRAVREVSRMEK
PLRRLSMVRQLLPNVGENSLHARLAKWCAGGRLGWVLDNPRDTVDLARSKLFGFDDTELLDDTEVSTPVT
MYLLHLTESLIDGRRFIYVMTEFWKRLGDPVFTDFAKNKQKTIRKQNGLGIFDTQSPADMLRSDIARALI
EQSATFFFLPNPRADYDDYVHGFKLTEAEFNIVRSLGENSRMFLIKQGHRSAIGKLDLAGLGDVLDVLSG
TTDNIQLLDTIRAQAGDDPEVWLPVFHAQLAKRRATQTTRQTQAPRAGGAQ
 
Nucleotide Sequence: 2466 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c2795702-2793237 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGCGGGCCGACACGAGACACGGTGCGGTCGCCCACCGCGAGGTGGCGATTGCTGACCACATTCCGTATT
CAACGCACGTCACGGACCATGTGATCAGGACGCGGGAAGGTGACTACCTGCAGATCTGGAAGCTCGCCGG
CATCGCATTCGAGGCCGCCGATCCGGTGGACATCCTCGTTCGTCACGATGGGTTCAACCAGCTCGTGCGT
GCACTGCCTGGTGGTCACGGTGCACTCTGGTCACACCGTCTGCGCCGGCGTGTTTCGGACCACTTTGCCA
CGCCTTATGGCAACCGCTTCTGCCAGGAGTTGGCGACACGTTACTACGCGAGCTTCGCGGGTTACCGGAT
GATGGCCAACGAGCTGTATCTGACGCTCGTCTATCGCCCCAACCGCACGAAGCTCGGACGCGTCTTCAGC
CGTGCGGCACGCCGCACGCGCGACGACATCCGGCGCGACCAGCAGGAGGCGCTGAAAGTAATGGACGAAC
TCGGCGCCCAGGTCGAGTCGGGGCTGAAGCCCTACGACCCGGTGGCGCTTGGGGTCTATCACAGGCCGAG
TCCCTTCACGAAGCGGCCGCGCCGGTATTCGTCGGCGCTGGAACTGCTCGGCTATCTCGTCAACGCAGTC
TGGGAGCCTGAGCCGGTTCCTTCTGGCGTGATTCGGGAGGCATTGCCGACTTCCCGTCTGTTCGTGGGTG
TAGAAAATGTCGAGATCCGCATGCCAGCCATGACGCGCTACGCCGCGCTGTTGGACCTGAAGGACTATCC
TGAAGAGACCGAGCCGGGGATGCTCAATGGCCTACTGTATGGCGATTTCGAGTACATCGAGACACAAAGC
TTCACGATCCTCGACAAACCTGGCGCGAAGGAAGCGTTAGAGCGTCAGCGCAACCAGCTGATCGCTGGCG
AGGATGTGGCCGTCTCCCAGGTCGAGGCGATGGATCGTGCGCTCAACGACCTGATCAACGGCGATTTCGT
GCTGGGTGAGTATCACTATTCGCTCGCGGTGCTGGCCGATACGCCCGCGGCGGTCTCGAAGCACGTGGCG
AAGGCCCGCACGCAACTCGCCGATGGCGGTTTCCAGACCACCCTTATCGATCTCGTGGCGGACGCTGCAT
GGTTCGCACAGTTGCCGGGCAACTGGCGTTACCGGCCGCGCGAAGCGAAGCTGACGTCCCGCAATTTCTG
TGGTCTTGCCAGTCTTCACAATTTCGCAACCGGCAAACGCGACGGCAATCCGTGGGGCGAGGCGATCACG
ATCGTCAAGACGCCGAGCGGCCAGCCGCTTTACCTGAATTTCCACGTTACGCCCGAGAAGCAGGATTCAG
CCGACGAGAAGGCGCTTGCCAATACCCAGATCATCGGTCAGGCCGGTGCGGGCAAGACGGTCCTCGAACT
GTTTCTGCTGGCGATGGCGACGAAGTTCGGGCTGACCGCGGTGCTGTATGACAAGGATCGCGGCACCGAG
ATCGCGATCCGTGCCATGGGCGGCATCTATACGGTGTTCCGCCGTGGCGAACCGACGGGGCTCAATCCGT
TCCAGATGACGCCGGACGAATCGGTGCTGGACTTCTGGGAGCGGCTGGTGCGCAAGCTCGTCGATACGGG
TGTGCCGTTGTCTGCCAAAGACGAATTGGACATCTCGCGTGCGGTGCGTGAAGTCTCCCGCATGGAAAAG
CCGTTGCGCCGCCTGTCGATGGTGCGACAACTGTTGCCGAATGTGGGCGAGAACAGTCTGCACGCACGTC
TCGCGAAATGGTGTGCAGGCGGGCGACTGGGCTGGGTCCTCGACAACCCGAGAGACACCGTGGACCTCGC
ACGCTCGAAGCTCTTCGGCTTCGACGATACCGAACTGCTCGATGACACGGAGGTTTCGACGCCCGTCACG
ATGTACCTGCTTCACCTGACGGAAAGCCTGATCGATGGCCGGCGCTTCATCTATGTGATGACCGAATTCT
GGAAGCGGCTGGGGGACCCCGTCTTCACGGACTTCGCGAAGAACAAACAGAAGACGATTCGCAAGCAGAA
CGGGCTCGGCATTTTCGATACCCAGTCACCGGCGGATATGCTGCGCAGCGATATCGCACGGGCACTGATC
GAACAGAGTGCGACGTTCTTCTTCCTGCCGAATCCGCGGGCCGACTACGACGACTACGTGCATGGCTTCA
AGCTGACGGAAGCCGAATTCAACATCGTGCGTAGTCTCGGCGAGAACAGCCGCATGTTTCTGATCAAGCA
AGGGCATCGGTCGGCGATCGGGAAACTCGATCTCGCTGGGCTCGGCGATGTGCTCGATGTCCTCTCGGGT
ACGACCGACAACATCCAACTCCTCGACACGATCCGTGCTCAGGCGGGGGACGACCCCGAGGTATGGCTGC
CGGTCTTCCATGCGCAACTGGCGAAGCGTCGGGCGACCCAGACAACCCGGCAAACCCAAGCACCCCGTGC
AGGAGGTGCGCAATGA
 Primer design