SecReT4
Protein ID: 187921150
T4SS name [ID]VirB [370]
Gene symbol-
Locus tagBphyt_6505
StrainBurkholderia phytofirmans PsJN
Repliconchromosome 2 [GenBank: NC_010676] [Browse all T4SS(s) in this replicon]
Location [Strand]2795704..2796048 [-]
Producttype IV secretory pathway VirB3 family protein
Component typeVirB3
UniProt IDB2T8Z6
KEGG IDbpy:Bphyt_6505
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 4.6e-14, Aligned region: 10..101
Protein Sequence: 114 a.a.     [Download]
>gi|187921150|ref|YP_001890182.1| type IV secretory pathway VirB3 family protein [Burkholderia phytofirmans PsJN]
MNPIMNSPISPLRDPVFKGCTRPAMLWGVPLVPFLMVGGGMLIPAIWALLASPPLGVGLLFLMIPVFVAM
RVITRRDDQRLAQYALRLRMVLRQGNRRFWGMHAYTPVRLKRRT
 
Nucleotide Sequence: 345 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c2796048-2795704 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGAACCCGATCATGAATTCGCCTATTAGTCCACTTAGGGATCCGGTCTTCAAGGGATGCACGCGGCCCG
CGATGCTCTGGGGTGTGCCGCTCGTGCCATTCCTCATGGTCGGTGGCGGCATGCTGATTCCTGCCATCTG
GGCATTGCTTGCCAGCCCACCGCTCGGTGTTGGGCTCCTGTTCCTGATGATCCCAGTGTTCGTCGCCATG
CGCGTTATCACGCGCCGCGACGACCAGCGTCTCGCGCAGTACGCACTGCGCCTGCGCATGGTCCTGCGGC
AGGGCAATCGCCGCTTCTGGGGTATGCACGCCTACACGCCGGTTCGCCTGAAGAGGAGGACCTGA
 Primer design