SecReT4
Protein ID: 187921151
T4SS name [ID]VirB [370]
Gene symbol-
Locus tagBphyt_6506
StrainBurkholderia phytofirmans PsJN
Repliconchromosome 2 [GenBank: NC_010676] [Browse all T4SS(s) in this replicon]
Location [Strand]2796065..2796406 [-]
Productconjugal transfer protein TrbC
Component typeVirB2
UniProt IDB2TB70
KEGG IDbpy:Bphyt_6506
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.6e-15, Aligned region: 22..109
Protein Sequence: 113 a.a.     [Download]
>gi|187921151|ref|YP_001890183.1| conjugal transfer protein TrbC [Burkholderia phytofirmans PsJN]
MNLVIHIIKKRAGRSPVVLSSDRRVARRVSVIATALLVASPAWAQLSQVNTLLGTIQTTLLGVGGVICSI
SIIWAGFRMMFQHARFGDIANVFIGGLFVGCATVIAGMLIPTS
 
Nucleotide Sequence: 342 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c2796406-2796065 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGAATTTAGTAATCCATATCATAAAGAAGAGGGCTGGACGTTCACCCGTCGTTCTTTCTTCTGACCGTC
GGGTGGCGCGGCGGGTTTCTGTCATCGCGACTGCGCTGCTAGTGGCGTCGCCCGCCTGGGCGCAACTGTC
GCAGGTCAATACGCTACTGGGCACGATCCAGACGACCCTGCTGGGTGTCGGTGGCGTGATCTGCTCGATT
TCGATCATCTGGGCGGGCTTCCGGATGATGTTCCAGCACGCCCGTTTCGGCGACATTGCGAACGTGTTCA
TCGGCGGTCTCTTCGTCGGTTGCGCGACAGTGATCGCCGGCATGCTGATTCCGACGAGTTGA
 Primer design