SecReT4
Protein ID: 187921152
T4SS name [ID]VirB [370]
Gene symbol-
Locus tagBphyt_6507
StrainBurkholderia phytofirmans PsJN
Repliconchromosome 2 [GenBank: NC_010676] [Browse all T4SS(s) in this replicon]
Location [Strand]2796448..2797095 [-]
ProductLytic transglycosylase catalytic
Component typeVirB1
UniProt IDB2TB71
KEGG IDbpy:Bphyt_6507
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 2.4e-22, Aligned region: 9..155
Protein Sequence: 215 a.a.     [Download]
>gi|187921152|ref|YP_001890184.1| Lytic transglycosylase catalytic [Burkholderia phytofirmans PsJN]
MMLPLDFATLAEQCAPQVSPVTMAAIVRTESGFNPYAIGVVRGRLLRQPGSAAEAVATAHTLAAAGWNFS
VGLAQVNRANWSAYGLTEQSAFDPCLNLAAGAAVLEGCFMAARAARVDGRRDPQAALRAGLSCYASGNFS
AGYRTGYVQRVVDNARVPASAPSHIVVPTIEPIPVVPALPVDRARSQPAGHQILEPPGNASDTNPGEPRA
SAVVF
 
Nucleotide Sequence: 648 bp     [Download]
>gi|187918714|ref|NC_010676.1|:c2797095-2796448 Burkholderia phytofirmans PsJN chromosome 2, complete sequence
ATGATGCTGCCTCTCGATTTCGCCACGCTTGCGGAGCAGTGCGCACCCCAGGTCTCGCCGGTCACGATGG
CGGCGATCGTGCGGACCGAGTCCGGATTCAATCCCTACGCGATCGGTGTTGTGCGTGGCCGGCTGCTACG
TCAGCCGGGAAGCGCAGCCGAAGCGGTGGCGACGGCGCACACACTTGCGGCCGCCGGATGGAACTTCAGC
GTCGGTCTCGCACAGGTCAACCGCGCGAACTGGAGCGCGTATGGACTAACCGAGCAGAGCGCCTTTGACC
CCTGTCTCAACCTGGCTGCGGGTGCCGCGGTTCTGGAGGGCTGTTTTATGGCCGCGCGCGCTGCGCGGGT
GGACGGCAGGCGCGATCCACAGGCTGCACTGCGGGCAGGGCTTTCGTGCTACGCCAGCGGTAATTTTTCG
GCGGGGTATCGCACCGGGTATGTGCAGCGCGTGGTCGATAACGCTCGCGTGCCTGCGTCGGCGCCGTCAC
ACATAGTCGTGCCGACGATTGAGCCCATTCCGGTCGTTCCGGCGTTGCCGGTGGACCGGGCGCGGTCACA
ACCGGCGGGTCATCAGATATTGGAGCCGCCGGGCAACGCTTCCGATACGAATCCCGGCGAGCCACGCGCA
AGCGCCGTGGTCTTCTAG
 Primer design