SecReT4
Protein ID: 187921966
T4SS name [ID]VirB [782]
Gene symbol-
Locus tagBphyt_7341
StrainBurkholderia phytofirmans PsJN
Repliconplasmid pBPHYT01 [GenBank: NC_010679] [Browse all T4SS(s) in this replicon]
Location [Strand]65197..66885 [+]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDB2TH73
KEGG IDbpy:Bphyt_7341
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.8e-99, Aligned region: 115..499
TraG-D_C [PF12696], Evalue: 1.2e-14, Aligned region: 362..479
T4SS-DNA_transf [PF02534], Evalue: 1.7e-13, Aligned region: 264..462
AAA_10 [PF12846], Evalue: 1.1e-06, Aligned region: 130..434
Protein Sequence: 562 a.a.     [Download]
>gi|187921966|ref|YP_001893555.1| type IV secretion system protein VirD4 [Burkholderia phytofirmans PsJN]
MVMRRYDDRYKPAAFFSVVLATFLVWFWSVHRLFVLPPAIFLAAWRAAKVTPDVPAIWVPTAVAFSYGLL
VMGVIFGYFKSGFEGADYVMYLRGARMVGHARLKDMTRKFFYKHLRIAGVPIPEWLEALHFRVIGSTGAG
KSVVISDYIESALARRERMICIDPNGQFMEKFYREGDIIINPFEARTKFWGIFNEIRTPYDVASYSISLI
PKSPSTEQEIWNAMARTISSEVMLKLWRLGIGDTDHLVYWLTIASNEQLMEMLADTAARGMFHGAEETIG
SVRAVLTRYITPHKYLSDIETVEGYFSLREWIDSNAEDQPNVWIIWREDQLASLKPLISCMFDVACNAAL
SKPITDETVATHLVVDEVDSLEKLNYLVPAATKGRKHRLHICAGMQSDAQLDGTNGKDDAMTVRNSLRTT
VALGIAEGDTYTAEQLSKGLGEHEVIRQRTTASDTGRDSHGQEVIKERVVIPSQITGLPNLTGYLKLAGD
WPICKFTMPYKKRKAVTEAFIMAQNRWTMDAEAANEQARMDFSRAKRAATDVDARDVDDDDSPSPALESS
RP
 
Nucleotide Sequence: 1689 bp     [Download]
>gi|187921867|ref|NC_010679.1|:65197-66885 Burkholderia phytofirmans PsJN plasmid pBPHYT01, complete sequence
ATGGTGATGCGTCGTTACGATGACAGATACAAGCCGGCGGCCTTCTTCAGCGTCGTGCTGGCGACGTTCC
TGGTCTGGTTCTGGTCTGTCCACCGACTATTCGTGTTGCCTCCGGCGATCTTTCTCGCCGCGTGGCGCGC
GGCAAAAGTCACCCCCGACGTTCCGGCCATATGGGTGCCAACCGCTGTTGCGTTCTCGTATGGTCTGCTC
GTAATGGGTGTTATTTTTGGCTACTTCAAAAGTGGTTTCGAAGGCGCTGATTATGTGATGTATCTGCGCG
GCGCGAGAATGGTCGGGCATGCGCGCCTCAAAGATATGACGAGGAAATTCTTCTATAAGCATCTTCGTAT
TGCCGGCGTTCCTATTCCTGAGTGGCTTGAGGCATTACATTTTCGCGTTATCGGGTCGACCGGTGCCGGT
AAATCGGTTGTGATATCAGATTATATCGAGTCGGCGCTCGCGCGACGCGAAAGAATGATCTGTATTGACC
CTAATGGTCAGTTCATGGAGAAATTTTATCGCGAAGGCGATATTATTATTAATCCGTTTGAGGCGCGGAC
AAAATTTTGGGGAATATTCAATGAAATCAGAACGCCCTACGATGTAGCCTCTTATTCGATAAGTTTGATA
CCGAAAAGCCCAAGCACCGAGCAGGAAATTTGGAATGCAATGGCCCGGACGATTAGCAGTGAAGTAATGC
TGAAACTCTGGCGGCTTGGCATTGGCGATACGGACCATCTGGTTTACTGGCTGACAATCGCGTCTAACGA
GCAATTAATGGAAATGCTCGCCGACACTGCTGCGCGCGGTATGTTTCACGGCGCGGAGGAAACGATTGGT
AGCGTTCGCGCGGTTCTGACACGCTATATCACTCCGCATAAATACCTTTCGGACATCGAGACCGTCGAAG
GCTATTTCAGCCTGCGCGAATGGATCGACTCGAACGCCGAGGATCAGCCCAACGTCTGGATTATCTGGCG
AGAGGACCAGCTTGCATCCCTGAAGCCGCTGATCTCATGCATGTTCGACGTTGCATGCAATGCCGCCCTC
TCCAAGCCAATTACGGATGAAACCGTCGCGACCCATCTGGTTGTTGACGAGGTGGACTCGCTCGAAAAGC
TCAACTACCTTGTGCCGGCCGCCACGAAGGGCCGAAAACACCGCCTGCATATTTGCGCGGGGATGCAGTC
TGACGCCCAGCTCGACGGCACCAACGGCAAAGACGACGCCATGACCGTTCGAAACAGCCTGCGCACGACC
GTCGCCCTTGGTATAGCCGAGGGTGATACCTATACCGCCGAACAACTGTCAAAGGGACTCGGTGAACATG
AGGTAATTCGGCAGCGCACCACGGCTTCGGACACTGGCCGCGACTCGCATGGGCAGGAAGTAATCAAGGA
ACGCGTGGTCATTCCCTCGCAGATCACTGGATTGCCGAACCTCACCGGCTATCTGAAGCTCGCGGGAGAC
TGGCCCATCTGCAAGTTCACGATGCCCTACAAGAAACGCAAGGCCGTTACCGAGGCGTTCATCATGGCGC
AGAACCGCTGGACGATGGATGCTGAAGCAGCCAACGAACAGGCGCGGATGGACTTCTCGCGCGCGAAGCG
TGCCGCAACTGACGTAGACGCTAGGGACGTTGATGACGACGACTCCCCTAGCCCCGCCCTCGAATCCTCC
CGGCCATAA
 Primer design