SecReT4
Protein ID: 187921975
T4SS name [ID]VirB [782]
Gene symbol-
Locus tagBphyt_7350
StrainBurkholderia phytofirmans PsJN
Repliconplasmid pBPHYT01 [GenBank: NC_010679] [Browse all T4SS(s) in this replicon]
Location [Strand]78670..79569 [+]
ProductType IV secretory pathway component VirB8 protein-like protein
Component typeVirB8
UniProt IDB2TH86
KEGG IDbpy:Bphyt_7350
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.2e-43, Aligned region: 13..231
Protein Sequence: 299 a.a.     [Download]
>gi|187921975|ref|YP_001893564.1| Type IV secretory pathway component VirB8 protein-like protein [Burkholderia phytofirmans PsJN]
MKTLKSAKTLTAEAADWDSHNAEKAEKRLKLLKLWAISATVVAVATTISVAPLMHFQHLQVAVMVFDKLT
RTYYMQNDAVLHDDDPDWQIRAESDLARYVKAHEGFTRGEADQNYKTVWLMDSQDLRASWDQYYRPDLNP
KGSPLSFMRASDAWTLKDYSFSFIPSSEPDIHVAQVRYTYVKKVGMTPPTQQRMVSTVSFKYTKENLPNN
VDDRMLNPVGFMATNYHRDDDGPIQPYSESGAAPTSAYPPVQTGTMPVQGAGSYAQAQPQSGQGYQATVM
NRLRQIMPGGNPANGGGAR
 
Nucleotide Sequence: 900 bp     [Download]
>gi|187921867|ref|NC_010679.1|:78670-79569 Burkholderia phytofirmans PsJN plasmid pBPHYT01, complete sequence
ATGAAAACGTTGAAGAGCGCCAAGACCCTGACCGCCGAGGCGGCAGATTGGGATTCGCATAACGCCGAAA
AAGCTGAAAAGCGGCTGAAGCTATTGAAGCTGTGGGCCATCAGTGCGACCGTCGTTGCGGTGGCGACAAC
AATCTCTGTCGCCCCGCTGATGCACTTCCAGCATCTGCAAGTGGCCGTCATGGTCTTCGACAAACTGACC
CGCACGTACTACATGCAGAACGATGCAGTCCTCCATGACGACGATCCCGATTGGCAAATCCGTGCCGAGT
CGGACCTTGCCCGCTATGTCAAGGCGCACGAGGGGTTCACGCGCGGCGAAGCGGATCAGAATTACAAGAC
GGTATGGCTCATGGACTCGCAGGATTTGCGCGCGTCGTGGGATCAATACTATCGTCCTGACCTTAATCCG
AAGGGGTCTCCACTCTCCTTTATGCGGGCGTCCGACGCGTGGACGCTGAAGGACTATTCCTTCTCGTTCA
TCCCGAGCAGCGAGCCGGACATTCATGTTGCGCAGGTGCGATACACCTACGTCAAGAAAGTCGGCATGAC
ACCGCCGACGCAACAGCGAATGGTATCGACGGTCTCCTTCAAGTACACGAAGGAAAACCTGCCCAACAAC
GTCGATGACCGCATGCTGAATCCGGTCGGTTTCATGGCAACGAACTACCATCGCGACGACGATGGTCCGA
TTCAACCGTATTCGGAAAGCGGCGCAGCGCCGACTTCCGCCTACCCGCCCGTGCAGACCGGAACGATGCC
GGTACAGGGTGCGGGGTCGTATGCGCAAGCCCAACCGCAGTCGGGTCAGGGCTATCAGGCTACGGTGATG
AACCGCCTGCGGCAGATTATGCCTGGCGGGAATCCGGCCAATGGGGGAGGCGCACGATGA
 Primer design