SecReT4
Protein ID: 187921978
T4SS name [ID]VirB [782]
Gene symbol-
Locus tagBphyt_7353
StrainBurkholderia phytofirmans PsJN
Repliconplasmid pBPHYT01 [GenBank: NC_010679] [Browse all T4SS(s) in this replicon]
Location [Strand]81766..82941 [+]
Producttype II secretion system protein E
Component typeVirB11
UniProt IDB2TH89
KEGG IDbpy:Bphyt_7353
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.1e-55, Aligned region: 55..367
Protein Sequence: 391 a.a.     [Download]
>gi|187921978|ref|YP_001893567.1| type II secretion system protein E [Burkholderia phytofirmans PsJN]
MSTTLDEQADAEQIDAEAEKPQRPLTIREQKYRQAEAEGMNPEALEALEFRMKLLYPFLDDEDTQEIVVN
EVGEIWSWKKGKWVVDKVPELTLEVLDSIGRNLANFSRKTFDRHHTSLSAFMPVTGERIEMTHPPTCPEN
TRYLNVRKHSVHTFQHESLVKAGYYEKTRHEFSSSVPKERRDELFEHLTDEEKELWTLITTGRFSEFMEK
AVEHHQNIVASGATGSGKTSYLRSLCEFIDHDERIITAEDTPEMPLPNHRNRNSLFYKKTDDGEGVNAKD
VLHSVMRKTPNRVLMAELRGDEAMYYLSGVLSSGHPGGLTTTHANSPKDAFFRLALLIKQSDAGQGLELQ
DILMLLRQTVNVVVQVTFNPKVGRYIPAIYYDPMYRLSLLD
 
Nucleotide Sequence: 1176 bp     [Download]
>gi|187921867|ref|NC_010679.1|:81766-82941 Burkholderia phytofirmans PsJN plasmid pBPHYT01, complete sequence
ATGAGCACCACACTTGACGAACAGGCGGACGCCGAGCAGATCGACGCAGAGGCTGAGAAGCCGCAACGGC
CACTAACGATACGCGAACAGAAGTACCGGCAGGCCGAAGCCGAAGGCATGAACCCGGAGGCTCTGGAAGC
TCTTGAGTTCCGCATGAAACTGCTTTATCCGTTCCTCGATGACGAAGACACGCAGGAAATCGTCGTCAAC
GAAGTGGGCGAGATATGGTCATGGAAGAAGGGCAAGTGGGTTGTCGACAAGGTTCCCGAACTGACCCTTG
AGGTTCTTGACTCAATCGGTCGGAACCTTGCCAACTTTTCCCGCAAGACGTTTGATCGACACCACACGTC
GTTGTCAGCCTTCATGCCAGTAACCGGCGAGCGGATCGAAATGACGCATCCGCCGACGTGCCCGGAGAAT
ACCCGCTATCTCAACGTGCGGAAACATTCTGTCCACACGTTCCAGCATGAGTCACTGGTAAAGGCCGGCT
ACTACGAGAAGACTCGACACGAGTTTTCGAGCAGCGTGCCAAAGGAGCGTCGGGACGAGTTGTTCGAGCA
CCTGACCGACGAAGAGAAGGAGCTGTGGACGCTCATCACCACGGGCCGTTTTTCCGAGTTCATGGAAAAA
GCGGTTGAGCATCACCAGAACATCGTGGCTTCGGGCGCGACCGGCAGCGGTAAGACTTCCTATCTTCGCT
CGCTGTGCGAATTTATTGACCACGACGAACGAATTATCACGGCCGAAGACACTCCCGAAATGCCTTTGCC
GAATCACCGGAACCGCAACAGCCTGTTCTACAAGAAGACTGACGACGGCGAAGGCGTTAATGCAAAGGAC
GTGCTTCACTCGGTGATGCGGAAGACGCCGAACCGCGTCCTGATGGCCGAGCTGCGAGGCGACGAGGCCA
TGTATTACCTGTCTGGTGTCCTCTCGTCAGGCCACCCAGGCGGCCTAACCACGACTCACGCTAACTCGCC
GAAGGACGCTTTTTTCCGGCTCGCGCTACTCATCAAGCAGTCGGACGCGGGCCAAGGTCTCGAACTGCAA
GATATTTTGATGTTGCTGCGACAAACTGTTAACGTAGTCGTGCAAGTCACGTTTAACCCGAAAGTGGGGC
GTTACATTCCGGCGATTTACTACGACCCGATGTACCGCCTTTCGCTCCTTGACTAA
 Primer design