SecReT4
Protein ID: 187922187
T4SS name [ID]VirB [153]
Gene symbol-
Locus tagBphyt_0166
StrainBurkholderia phytofirmans PsJN
Repliconchromosome 1 [GenBank: NC_010681] [Browse all T4SS(s) in this replicon]
Location [Strand]180178..180342 [+]
Producthypothetical protein
Component typeVirB8
UniProt IDB2T044
KEGG IDbpy:Bphyt_0166
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 54 a.a.     [Download]
>gi|187922187|ref|YP_001893829.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MSRSTVAILIVQLVMLMNGCSDSLPKLVLPDGSHRVPVNRVQPVPPSDGGSHEQ
 
Nucleotide Sequence: 165 bp     [Download]
>gi|187922035|ref|NC_010681.1|:180178-180342 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGAGCCGATCCACCGTGGCAATCCTGATCGTTCAGTTAGTCATGCTGATGAATGGGTGTTCGGACAGTC
TACCCAAACTAGTCCTGCCGGACGGTTCGCATCGCGTGCCGGTGAATCGCGTGCAACCGGTTCCTCCTTC
CGACGGAGGCAGCCATGAGCAGTGA
 Primer design