SecReT4
Protein ID: 187922191
T4SS name [ID]VirB [153]
Gene symbol-
Locus tagBphyt_0170
StrainBurkholderia phytofirmans PsJN
Repliconchromosome 1 [GenBank: NC_010681] [Browse all T4SS(s) in this replicon]
Location [Strand]183124..184251 [+]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDB2T048
KEGG IDbpy:Bphyt_0170
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 9.3e-62, Aligned region: 35..341
FtsK_SpoIIIE [PF01580], Evalue: 4e-05, Aligned region: 182..213
Protein Sequence: 375 a.a.     [Download]
>gi|187922191|ref|YP_001893833.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MNAQAHIHDEAATGADTLLPRLADDASVRELMRPFAGLLDDSSVTELVINRPQRVLTETHLGWQPHDCAD
LDFERLMSFAVAVATLTNQEVSARHPILSALLPGDARIQIVVPPVVPPRTVSITIRRPSAREKTLDAYRS
EGLFGEAVWRRQDELDTSRPALRPAVNRLLHYLEARDWSTFFDLAVKARLNIVVVGNTGSGKTSFMRTLC
RSIPSSERIITIEDVRELFIRHIENSVHLLYSKGGHGQADVTPADLIACTMRMRPDRVLLAELRGAEAYD
FLKLLTTGHSGSITSYHASSASVAIERFALMAKEHPEAATWDDAALRRLLFMTIDVVAHMEAVALFDETG
VQTGRRWSMTEVWFDPLRRHQADFR
 
Nucleotide Sequence: 1128 bp     [Download]
>gi|187922035|ref|NC_010681.1|:183124-184251 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGAACGCGCAGGCCCACATCCACGATGAAGCGGCCACGGGCGCTGATACGTTGCTGCCGAGGCTGGCCG
ACGATGCGTCCGTGCGGGAGCTGATGCGGCCGTTCGCCGGCCTGCTCGATGACTCCTCGGTCACGGAGCT
GGTGATCAACCGGCCGCAGCGGGTGCTGACCGAAACCCATCTCGGCTGGCAGCCACACGACTGTGCGGAC
CTCGACTTCGAGCGCCTGATGTCGTTTGCGGTCGCGGTCGCCACGCTCACGAACCAGGAGGTGTCGGCCC
GGCATCCCATCCTGTCCGCACTTCTGCCGGGTGACGCGCGTATCCAGATTGTGGTGCCACCCGTCGTACC
ACCGCGCACGGTCTCGATTACGATCCGGCGCCCGTCCGCGCGCGAGAAAACCCTTGATGCGTACCGCAGC
GAAGGCCTCTTTGGGGAAGCCGTATGGCGTCGCCAGGATGAGCTCGACACGTCGCGCCCGGCGCTGCGGC
CTGCGGTTAACAGGCTCCTTCACTACCTGGAGGCGCGGGATTGGAGCACGTTCTTCGACCTGGCGGTGAA
GGCCCGTCTGAATATTGTGGTCGTCGGCAATACGGGTTCGGGCAAAACCAGTTTCATGCGAACCCTGTGC
CGCTCCATCCCGTCGTCCGAACGAATCATCACGATCGAGGACGTTCGGGAGCTGTTTATCCGGCATATCG
AAAACAGTGTGCACCTGTTGTACAGCAAGGGCGGACATGGCCAGGCGGATGTGACCCCGGCTGACCTGAT
CGCATGCACGATGCGCATGCGTCCCGACCGTGTGCTGCTTGCCGAACTGCGCGGTGCCGAAGCCTATGAC
TTCCTGAAGCTGCTGACCACGGGACACTCGGGTTCGATCACCAGCTATCACGCGTCGAGCGCATCGGTGG
CCATCGAGCGGTTCGCGCTGATGGCGAAGGAGCATCCCGAAGCCGCTACGTGGGACGACGCAGCACTGCG
GCGGCTCCTCTTCATGACGATCGACGTGGTGGCGCATATGGAGGCAGTTGCGCTCTTCGACGAGACCGGT
GTCCAGACCGGCCGGCGCTGGTCCATGACGGAAGTCTGGTTCGATCCGCTGCGCCGCCATCAGGCGGACT
TCCGCTGA
 Primer design