SecReT4
Protein ID: 187922193
T4SS name [ID]VirB [153]
Gene symbol-
Locus tagBphyt_0172
StrainBurkholderia phytofirmans PsJN
Repliconchromosome 1 [GenBank: NC_010681] [Browse all T4SS(s) in this replicon]
Location [Strand]184673..186457 [+]
ProductTRAG family protein
Component typeVirD4
UniProt IDB2T050
KEGG IDbpy:Bphyt_0172
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.8e-109, Aligned region: 15..452
TraG-D_C [PF12696], Evalue: 1.6e-28, Aligned region: 298..419
TrwB_AAD_bind [PF10412], Evalue: 9.2e-22, Aligned region: 208..433
Protein Sequence: 594 a.a.     [Download]
>gi|187922193|ref|YP_001893835.1| unnamed protein product [Burkholderia phytofirmans PsJN]
MSTMANPGVYDSGPPLVVGVWHGRYLRFAGQQFVLLAAPARSGKGVGIVVPNLLSYPDSVVVLDIKQENF
HLTAGFRRAHGHDVYLFNPFAEDGRTHRYNPLSAISGGVFRVGDILAIGYALYPVGGHDDFWKDQARNLF
LGIVLLLCEWRDARRAGNTDAPDCPVTMGEVLRQSSGNGMPVKAYLQQALLQNRRRLSGACIDALNRFLA
NDDKVLASILATFNAPLTIFANPIVDAATSANDFDLRDVRRRRMSVYVGITPDHLTEAALLVNLLFSQLV
NLNTKELPQDNPALKIQCLLLMDEFTSVGKIHIIARAVAYMAGYNLRLLSIVQSVSQLESVYGRADARTF
VTNHAMQIIYAPREQKDANEYSEMLGTFTDRSRSVSRSNAIFGGRGGSSESFSEQRRPLLLPQELKELGR
EKEIILLENTKPILAERICYWRDPVFTSRLAAAPAIPAMDLVRFTAQVERRLRDLQPDDMDEAGVLHVSP
EYLEVLQTWDPRELPRHLNDISDEEAAAYVERHFILLGVPAKGVAVAARRLSPSDLDVAELRPADGVPKA
HAARGTGASRKRQGRTPSRTAEGSNVVPLHGDRR
 
Nucleotide Sequence: 1785 bp     [Download]
>gi|187922035|ref|NC_010681.1|:184673-186457 Burkholderia phytofirmans PsJN chromosome 1, complete sequence
ATGAGCACGATGGCGAACCCCGGCGTCTACGACAGCGGGCCGCCGCTGGTCGTGGGCGTGTGGCACGGCC
GCTATCTGCGGTTTGCCGGCCAGCAGTTCGTGCTGCTCGCAGCGCCTGCGCGCTCAGGCAAGGGCGTGGG
TATCGTGGTGCCCAACCTGCTGAGCTACCCCGATTCGGTGGTGGTGCTCGACATCAAGCAGGAGAATTTC
CACCTCACCGCGGGCTTCCGTCGGGCGCACGGGCACGACGTGTACCTGTTCAACCCGTTTGCGGAGGATG
GCCGTACGCACCGGTACAACCCGCTGTCGGCCATATCGGGTGGCGTTTTCCGCGTCGGTGACATTCTCGC
GATCGGCTACGCGCTGTACCCGGTCGGTGGTCACGACGACTTCTGGAAAGACCAGGCGCGCAACCTTTTC
CTCGGCATCGTGCTGCTGCTGTGCGAATGGCGCGATGCGCGCCGCGCGGGCAATACCGATGCGCCCGACT
GTCCGGTGACGATGGGCGAGGTGCTGCGCCAGTCGTCGGGCAACGGCATGCCAGTCAAGGCGTATCTCCA
GCAGGCATTGCTGCAGAACCGGCGGCGGCTCAGCGGTGCGTGCATCGACGCGCTGAACCGCTTCCTCGCG
AACGACGACAAGGTGCTCGCGAGCATCCTCGCGACCTTCAATGCACCGCTCACGATCTTCGCCAATCCGA
TTGTCGATGCGGCCACAAGCGCCAATGACTTCGACCTGCGTGACGTGCGCAGGCGCCGCATGTCGGTCTA
TGTCGGCATCACACCGGACCACCTGACCGAGGCGGCACTTCTCGTCAACCTCCTGTTCTCACAGCTGGTC
AATCTGAACACCAAGGAACTGCCGCAGGACAACCCGGCGCTGAAGATTCAGTGCCTGCTGCTGATGGACG
AGTTCACCTCGGTCGGCAAGATCCACATCATTGCCCGCGCGGTCGCCTACATGGCGGGCTATAACCTGCG
GCTGCTCTCGATCGTGCAGTCGGTCTCGCAGCTCGAGTCGGTGTATGGCCGGGCGGACGCGAGAACGTTC
GTCACGAATCACGCGATGCAGATCATCTATGCACCGCGCGAGCAGAAGGACGCGAACGAATACTCGGAGA
TGCTCGGCACCTTTACGGACCGCTCGCGTAGCGTGAGCCGGTCGAACGCGATCTTCGGCGGACGCGGTGG
GTCGAGCGAGAGTTTTTCGGAACAGCGCCGGCCGCTGCTGTTGCCGCAGGAGCTGAAAGAGCTCGGGCGC
GAGAAGGAAATCATCCTGCTCGAAAACACCAAACCCATCCTGGCGGAACGCATCTGCTACTGGCGTGATC
CGGTTTTCACGTCACGCCTTGCGGCCGCCCCGGCAATTCCCGCGATGGACCTCGTGCGCTTCACCGCCCA
GGTCGAGCGGCGGTTAAGGGATCTGCAACCCGATGACATGGATGAAGCCGGCGTCCTGCACGTATCCCCG
GAATATCTGGAAGTGCTGCAGACATGGGATCCGCGCGAGCTGCCGCGGCATCTGAACGACATCAGCGATG
AAGAGGCAGCCGCGTACGTCGAGCGGCATTTCATCCTGTTGGGCGTACCGGCCAAAGGGGTCGCGGTAGC
GGCACGCCGACTGTCGCCATCCGATCTCGATGTCGCGGAACTGCGCCCCGCGGATGGCGTCCCCAAAGCG
CATGCCGCGCGCGGTACAGGCGCCTCGCGGAAACGCCAGGGGCGCACCCCGTCGCGCACCGCTGAGGGTT
CGAACGTCGTGCCGCTTCATGGAGACCGCCGATGA
 Primer design