SecReT4
Protein ID: 187928608
T4SS name [ID]Trb [793]
Gene symbol-
Locus tagRpic_1524
StrainRalstonia pickettii 12J
Repliconchromosome 1 [GenBank: NC_010682] [Browse all T4SS(s) in this replicon]
Location [Strand]1617292..1617636 [-]
Producthypothetical protein
Component typeTrbC
UniProt IDB2UCL1
KEGG IDrpi:Rpic_1524
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 114 a.a.     [Download]
>gi|187928608|ref|YP_001899095.1| hypothetical protein Rpic_1524 [Ralstonia pickettii 12J]
MIQAVQRLLKRATTWRGTVAQAVAITTLLYGAEARADELASLSGFVCMIANFVKSGYLLAGGVIVIVIGA
IAIAQSESTIVKFVSTIGIGIGIAAACIPLLQKFGISATYCTFV
 
Nucleotide Sequence: 345 bp     [Download]
>gi|187927112|ref|NC_010682.1|:c1617636-1617292 Ralstonia pickettii 12J chromosome 1, complete sequence
ATGATCCAAGCAGTCCAGCGCCTGCTCAAACGCGCAACCACCTGGCGCGGCACGGTGGCACAAGCCGTTG
CCATCACCACCCTGCTCTATGGGGCGGAGGCCCGCGCCGACGAATTGGCCTCTCTGTCCGGTTTCGTTTG
CATGATCGCGAACTTCGTCAAGAGCGGCTACCTGCTCGCGGGCGGCGTGATTGTGATCGTGATCGGTGCA
ATCGCCATCGCGCAGTCCGAATCCACCATCGTCAAATTCGTCTCGACGATTGGTATCGGTATCGGCATTG
CAGCGGCTTGTATCCCGCTGCTGCAGAAGTTCGGCATCTCCGCCACGTACTGCACGTTCGTCTAA
 Primer design