SecReT4
Protein ID: 187928611
T4SS name [ID]Trb [793]
Gene symbol-
Locus tagRpic_1527
StrainRalstonia pickettii 12J
Repliconchromosome 1 [GenBank: NC_010682] [Browse all T4SS(s) in this replicon]
Location [Strand]1619830..1620711 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDB2UCL4
KEGG IDrpi:Rpic_1527
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.7e-53, Aligned region: 71..284
Protein Sequence: 293 a.a.     [Download]
>gi|187928611|ref|YP_001899098.1| conjugal transfer protein TrbG [Ralstonia pickettii 12J]
MTMSLLRTTSSALACACLALAVVGGAWAAAERPAKRAEPVIPPLNLGSMADAMNPMNPFNGGAEPLAMPG
DSRLVVFTYSKDQIYRVLTAPLKGTTIEFPDDEQIVSEPAWGDSVRWESSTDNGNHLYLKPHAAGLVNTL
SVTTNKRSYEFTLVSSPLGGIFYQKVRFRIPETVMAKIKARADGEAREQGERPANTVGVSPDKLNFDYST
SGSADFKPDAVFDDGKLIWMRMPATASEWPVALVKDGSDFVVANFIRRGDYLVLQRLAETVALRSGSTEV
IVRRGRGRFLGLF
 
Nucleotide Sequence: 882 bp     [Download]
>gi|187927112|ref|NC_010682.1|:1619830-1620711 Ralstonia pickettii 12J chromosome 1, complete sequence
ATGACCATGTCCCTATTGCGCACAACTTCCTCGGCGCTCGCATGCGCTTGTCTCGCGCTGGCTGTTGTCG
GAGGCGCGTGGGCTGCTGCCGAGCGCCCCGCGAAGCGCGCCGAACCTGTTATCCCCCCGCTGAACTTGGG
ATCAATGGCGGATGCCATGAACCCCATGAATCCGTTCAACGGTGGAGCGGAACCGCTGGCTATGCCGGGC
GATTCCCGCCTCGTCGTCTTTACGTACAGCAAGGATCAGATTTATCGCGTCCTGACCGCGCCACTGAAGG
GAACCACCATTGAGTTCCCGGACGATGAGCAGATCGTGTCGGAGCCGGCGTGGGGTGACAGCGTGCGCTG
GGAATCGTCAACGGACAACGGCAATCATCTCTATCTCAAGCCGCACGCTGCCGGTCTGGTCAACACCCTG
TCGGTGACCACAAACAAGCGCTCCTACGAGTTCACGCTGGTGTCGTCCCCCCTGGGCGGGATCTTCTACC
AGAAGGTTCGCTTCCGCATCCCTGAGACCGTGATGGCCAAGATCAAGGCGCGGGCAGATGGCGAGGCACG
CGAGCAGGGAGAGCGTCCGGCGAACACCGTCGGCGTTTCGCCGGACAAGCTCAACTTCGACTATTCGACG
TCGGGAAGCGCGGACTTCAAGCCCGACGCTGTCTTTGATGACGGCAAGCTCATCTGGATGCGCATGCCCG
CGACTGCCAGCGAGTGGCCCGTCGCGCTGGTGAAGGACGGAAGTGATTTCGTCGTAGCGAACTTCATTCG
CCGAGGCGACTACCTCGTGCTGCAGCGCCTGGCAGAGACCGTGGCGCTTCGGTCGGGTAGCACGGAGGTG
ATCGTGCGCCGCGGCCGCGGTCGCTTCTTGGGTCTCTTCTAA
 Primer design