SecReT4
Protein ID: 187929714
T4SS name [ID]Trb [330]
Gene symbol-
Locus tagRpic_2643
StrainRalstonia pickettii 12J
Repliconchromosome 1 [GenBank: NC_010682] [Browse all T4SS(s) in this replicon]
Location [Strand]2757009..2759027 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDB2UAH2
KEGG IDrpi:Rpic_2643
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.4e-102, Aligned region: 112..558
TraG-D_C [PF12696], Evalue: 2.8e-31, Aligned region: 404..524
TrwB_AAD_bind [PF10412], Evalue: 6.4e-30, Aligned region: 172..539
Protein Sequence: 672 a.a.     [Download]
>gi|187929714|ref|YP_001900201.1| conjugal transfer coupling protein TraG [Ralstonia pickettii 12J]
MQGTNVLFGQIAVVFGIVIAGVWSATQWTAAALGYQLRLGSPWFDFFGTPVYHPWGLFEWWFFFDAYAPH
IFDAGGAIAAGSGLIAMVVAIGMSIWRSRQSKLVTTYGSARWANAEDIHKAGLDQPAGVFLGLHRQQYLR
HEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKGENWSITAGWRSRFSHCLLFNPTDAKSSAYN
PLLEVRRGAHEVRDVQNIADILVDPEGALERRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPA
CPFELTLHRMMTTPHIGGGPHLVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIA
DLIAAEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIARRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLGTATELRAQRN
YAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDEAVVMVSSVAPIKAKKLRYYADSNFKRRVLPPPV
LATLSMQGRYADVPPERADDWSGLAIPAMPVAPTADAADGLENLGSADDSGPRRQPELSEAVTYDPDLVA
PAADLGLLDDDDMPHPLPRQLDPALQRTARLASLDPDDGIDL
 
Nucleotide Sequence: 2019 bp     [Download]
>gi|187927112|ref|NC_010682.1|:2757009-2759027 Ralstonia pickettii 12J chromosome 1, complete sequence
ATGCAAGGAACGAACGTGCTGTTCGGTCAGATTGCCGTCGTCTTCGGCATCGTGATCGCTGGCGTATGGA
GCGCCACGCAATGGACAGCAGCGGCCCTGGGCTACCAGCTACGCCTGGGCTCGCCGTGGTTCGACTTCTT
CGGTACGCCGGTCTACCACCCCTGGGGCCTGTTCGAGTGGTGGTTCTTCTTCGACGCCTACGCGCCGCAT
ATCTTCGACGCGGGCGGTGCCATTGCCGCAGGCAGCGGCCTGATCGCGATGGTAGTTGCCATCGGCATGT
CGATCTGGCGCTCGCGCCAGTCCAAGCTGGTCACGACCTACGGCTCGGCCCGCTGGGCCAATGCGGAGGA
CATCCACAAGGCGGGCCTTGACCAGCCTGCGGGCGTGTTCCTCGGCCTGCATCGCCAGCAGTACCTGCGC
CATGAAGGCCCGGAACACGTCCTGACATTCGCGCCCACCCGCTCGGGCAAAGGCGTGGGCCTGGTGGTTC
CCACCTTGTTGAGCTGGCCTGCATCGGCCGTCATTCACGACATCAAGGGCGAGAACTGGAGCATCACCGC
CGGCTGGCGCTCGCGCTTCTCGCATTGCCTGCTGTTCAACCCGACCGATGCGAAGTCGTCGGCCTACAAC
CCACTGCTGGAGGTGAGGCGCGGCGCGCACGAAGTGCGCGACGTGCAGAACATCGCAGACATTCTGGTCG
ATCCCGAAGGAGCACTGGAGCGGCGCAACCATTGGGAGAAGACCTCGCATGCGCTGCTGGTTGGGGCCAT
CCTGCACGTGCTCTACGCAGGCGAAGACAAGACGCTGCGCGGAGTCGCCAACTTCCTCAGCGACCCGGCC
TGTCCCTTCGAGCTGACCCTGCATCGGATGATGACCACGCCGCACATCGGTGGTGGGCCGCATCTGGTGG
TGGCATCGGCAGCGCGCGAAGTCCTGAACAAATCGGACAACGAGCGTTCCGGCGTGTTGAGCACCGCCAT
GTCATTCCTCGGCCTGTACCGCGACCCCACGGTGGCCGAAGTCACCTCGCGCTGCGACTGGCGCATTGCC
GACCTGATCGCGGCCGAGCATCCGGTGTCGCTGTACCTGGTGGTGCCGCCTTCGGACATTTCGCGGACGA
AACCGCTCATTCGCCTGATCCTCAACCAGATCGGGCGACGGCTGACGGAATCGCTCGACGGCAGCGACGG
CATCGCGCGCCGCCACAAGCTGCTATTGATGCTCGACGAGTTCCCCGCGCTCGGACGGCTCGACTTCTTC
GAGACGGCCCTGGCCTTCATGGCCGGCTACGGTATCCGCAGCTTCCTCATCGCCCAGTCGCTCAACCAGA
TTGACAAAGCCTACGGCCAGAACCATTCGATCCTGGACAACTGCCATGTCCGGGTGACGTTCGCCACCAA
CGACGAGCGCACCGCCAAGCGCATCTCCGAAACGCTGGGCACCGCGACCGAGCTGCGCGCGCAGCGCAAC
TACGCCGGCCACCGGCTCGCGCCATGGCTCGGGCATCTGATGGTGTCGCGCCAGGAGACGGCACGTCCGC
TGCTCACGCCGGGCGAGGTAATGCAGCTTCCGCCCGACGAGGCCGTGGTGATGGTGTCCAGCGTGGCGCC
CATCAAGGCCAAGAAGCTGCGCTACTACGCGGACAGCAATTTCAAGCGGCGCGTGCTTCCGCCGCCGGTG
CTTGCAACCCTGTCCATGCAGGGGCGCTATGCCGATGTGCCACCGGAACGCGCCGACGACTGGAGCGGGC
TGGCGATTCCCGCCATGCCGGTCGCACCGACGGCCGACGCCGCCGATGGGCTGGAGAACCTGGGTTCGGC
CGACGACAGCGGCCCACGCCGCCAGCCCGAACTTTCCGAAGCCGTCACCTACGACCCCGACCTGGTTGCG
CCCGCAGCCGACCTCGGGCTGCTCGATGACGACGACATGCCGCATCCCCTTCCTCGCCAGCTCGATCCGG
CCCTGCAGCGCACGGCCCGGCTGGCTTCCCTCGACCCTGACGACGGAATCGACCTATGA
 Primer design