SecReT4
Protein ID: 187929716
T4SS name [ID]Trb [330]
Gene symbol-
Locus tagRpic_2645
StrainRalstonia pickettii 12J
Repliconchromosome 1 [GenBank: NC_010682] [Browse all T4SS(s) in this replicon]
Location [Strand]2759485..2760522 [+]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDB2UAH4
KEGG IDrpi:Rpic_2645
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.3e-80, Aligned region: 27..293
TrwB_AAD_bind [PF10412], Evalue: 6.8e-07, Aligned region: 142..186
FtsK_SpoIIIE [PF01580], Evalue: 3.3e-05, Aligned region: 145..204
Protein Sequence: 345 a.a.     [Download]
>gi|187929716|ref|YP_001900203.1| P-type conjugative transfer ATPase TrbB [Ralstonia pickettii 12J]
MSAVPSSFTATSLDRRIQMLRTAMGPLIAAALEDPDVVEIMLNPDRTLWVDRLSTGRAPMGVELSEADGE
RIIRLVAAHVGTEVHRGQPLLTAELPETGERFEGILPPAAPGPAFALRKRAFGVIPLSRYIEDGMMTAAQ
AGLLVRAVRERQNILIAGGTSTGKTTLANALLAEIAATGDRVLVLEDTVELQCAARDHVPLRTRQGVVSM
TELVRSSMRLRPDRVIVGEVRGAEALDLIKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAENPPRAL
IAEAVNVVIHIAGRGRKRRIESIARVVGFDGAGYQLADALEAPFPELLSQSDLSSLSPDQPGELP
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|187927112|ref|NC_010682.1|:2759485-2760522 Ralstonia pickettii 12J chromosome 1, complete sequence
ATGAGCGCCGTTCCTTCCTCCTTCACGGCCACCTCGCTGGATCGCCGCATCCAGATGCTGCGCACGGCCA
TGGGGCCGCTGATCGCTGCCGCGCTCGAAGACCCGGACGTGGTGGAAATCATGCTCAACCCCGATCGCAC
GCTCTGGGTGGATCGTCTGTCCACGGGCCGCGCGCCGATGGGCGTGGAACTGTCCGAGGCCGATGGCGAA
CGCATCATCCGCCTCGTTGCAGCTCACGTTGGCACGGAAGTTCATCGGGGCCAGCCGTTGTTGACGGCAG
AGCTGCCCGAGACGGGCGAACGCTTCGAGGGCATCCTGCCGCCCGCCGCGCCGGGGCCGGCCTTCGCCTT
GCGCAAGCGCGCCTTTGGCGTGATCCCACTGTCGCGCTACATCGAGGACGGAATGATGACCGCCGCGCAG
GCGGGCCTGCTGGTGCGCGCCGTGCGCGAGCGCCAGAACATCCTGATCGCAGGCGGCACCAGCACGGGCA
AGACCACGCTCGCCAATGCCTTGCTCGCCGAGATTGCCGCTACCGGTGACCGCGTGCTGGTGCTTGAAGA
CACGGTGGAGCTGCAATGCGCGGCGCGCGATCACGTACCGCTGCGCACGCGCCAGGGCGTGGTGTCGATG
ACCGAGCTGGTGCGCTCTTCCATGCGCCTGCGCCCGGATCGCGTGATCGTTGGCGAAGTGCGTGGTGCCG
AGGCGCTGGATCTCATCAAGGTATGGGGCACGGGCCACCCCGGCGGCATCGCCACCATCCACGCCGGCTC
CGCGCTGGGCGCGCTGCTGCGCCTGGAGCAACTGATTCTCGAAGTGGCGGAGAACCCGCCCCGTGCGCTG
ATCGCGGAAGCGGTCAACGTGGTCATCCACATCGCCGGGCGCGGACGCAAGCGCCGCATCGAGAGCATCG
CCCGCGTCGTCGGCTTCGATGGCGCGGGCTACCAACTGGCGGATGCGCTGGAGGCTCCATTCCCGGAGCT
GCTGTCGCAGTCCGACCTTTCTTCCCTGTCCCCTGACCAACCTGGAGAACTGCCATGA
 Primer design