SecReT4
Protein ID: 187929717
T4SS name [ID]Trb [330]
Gene symbol-
Locus tagRpic_2646
StrainRalstonia pickettii 12J
Repliconchromosome 1 [GenBank: NC_010682] [Browse all T4SS(s) in this replicon]
Location [Strand]2760519..2760911 [+]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDB2UAH5
KEGG IDrpi:Rpic_2646
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.6e-25, Aligned region: 30..120
Protein Sequence: 130 a.a.     [Download]
>gi|187929717|ref|YP_001900204.1| conjugal transfer protein Trbc [Ralstonia pickettii 12J]
MTQMIVPAFRISANPLALRCRPARLDGLARPALQGLMLAALMLLLAGTAQAAGSSMPWEGPLQSILESIQ
GPVARIIAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 393 bp     [Download]
>gi|187927112|ref|NC_010682.1|:2760519-2760911 Ralstonia pickettii 12J chromosome 1, complete sequence
ATGACGCAGATGATCGTTCCTGCTTTCCGTATTTCTGCAAACCCGCTTGCCCTGCGCTGCCGTCCCGCGC
GGCTGGATGGCTTGGCACGCCCAGCCCTGCAGGGCCTGATGCTCGCGGCGCTGATGCTGCTGCTCGCAGG
CACCGCGCAGGCCGCCGGTTCCTCGATGCCTTGGGAGGGGCCGCTGCAATCCATCCTGGAGTCGATCCAG
GGTCCGGTGGCCCGGATCATCGCGGTCATCATCATCATCGCCACGGGCCTGGCGCTGGCCTTCGGCGATA
CCTCGGGCGGTTTTCGCAAGCTGATCCAGATCGTCTTCGGTCTGTCGATCGCGTTTGCCGCGTCCTCGTT
CTTCCTGTCGTTCTTCAGCTTCTCGGGCGGGGCTGTCGTATGA
 Primer design