SecReT4
Protein ID: 187929718
T4SS name [ID]Trb [330]
Gene symbol-
Locus tagRpic_2647
StrainRalstonia pickettii 12J
Repliconchromosome 1 [GenBank: NC_010682] [Browse all T4SS(s) in this replicon]
Location [Strand]2760908..2761192 [+]
Productputative conjugal transfer TrbD transmembrane protein
Component typeTrbD
UniProt IDB2UAH6
KEGG IDrpi:Rpic_2647
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 4.9e-11, Aligned region: 17..88
Protein Sequence: 94 a.a.     [Download]
>gi|187929718|ref|YP_001900205.1| putative conjugal transfer TrbD transmembrane protein [Ralstonia pickettii 12J]
MSAAHDGVQGFAPGFEVPLHRSLTEPILLGGAPRTVAIANGTLAAAVGLGLQLWIPGLVLWIAGHALAVW
GARVDPRFMQVFARHIKHRPLLDV
 
Nucleotide Sequence: 285 bp     [Download]
>gi|187927112|ref|NC_010682.1|:2760908-2761192 Ralstonia pickettii 12J chromosome 1, complete sequence
ATGAGCGCGGCCCACGATGGCGTGCAGGGGTTCGCTCCGGGGTTCGAAGTGCCACTGCACCGCTCGCTGA
CCGAGCCGATCCTGCTGGGCGGCGCGCCGCGCACGGTGGCGATTGCCAATGGCACCTTGGCCGCGGCCGT
GGGCTTGGGCCTGCAACTGTGGATTCCGGGCCTGGTGCTCTGGATCGCCGGCCATGCGTTGGCGGTCTGG
GGCGCGCGTGTCGATCCGCGGTTCATGCAAGTCTTCGCGCGCCATATCAAGCACCGGCCGCTGCTGGACG
TGTAG
 Primer design