SecReT4
Protein ID: 187929719
T4SS name [ID]Trb [330]
Gene symbol-
Locus tagRpic_2648
StrainRalstonia pickettii 12J
Repliconchromosome 1 [GenBank: NC_010682] [Browse all T4SS(s) in this replicon]
Location [Strand]2761212..2763689 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDB2UAH7
KEGG IDrpi:Rpic_2648
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5e-38, Aligned region: 442..711
CagE_TrbE_VirB [PF03135], Evalue: 6.1e-15, Aligned region: 273..388
DUF853 [PF05872], Evalue: 3.1e-08, Aligned region: 595..684
Protein Sequence: 825 a.a.     [Download]
>gi|187929719|ref|YP_001900206.1| conjugal transfer ATPase TrbE [Ralstonia pickettii 12J]
MLNLAEYRQRPALLADWLPWAGLIAPGVVLNKDGSFQRTARFRGPDLDSATQGELISTSARLNNALRRLG
SGWALFIEAERRPAANYPHSEFPEPLSWLVDEERRAAFEDLGNHFESGYHLTLVYLPPEEARARAAGLLY
ENRLTEGVDWRERLTAFIAETERIFDLLDGVMPEIAWLDDSQTLTYLHATVSTRRYRVGVPEVPFHLDAL
LADAPLIGGLAPMLGDQHLRVVSVRGFPISTWPGILDDLNRLGFAYRWSTRFLCLDKAEAEKELARLRRQ
WFAKRKNVIALLRETIFQQESPLVDTDASNKATDADAALQELGSDQVAFGYVTATVTVMDADAAVANEKL
RRVERVIQGRGFVTIPETLNAVDAWLSSIPGHAYANVRQPIVSTLNLAHLMPVSAVWAGPEKNAHLDGPP
LIVTRTEGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYRGSRIFAFDMGRSMRATILGLG
GEHYDLGMDGEIAFQPLARIDREGYRTWAAEWIEGRLRHESVAVGPEEKAAIWSALGSLAGAPMEQRTMT
GLSVLLQSNALRQALAPYVLGGAHGKLLDADSDRLGAGSVQCFEMEELMHSKAAVMAVLHYLFARFDERF
DGAPTLLILDEAWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPN
PQATEPQIRTIYEGFGLNLRQIEIVATAQPKRDYYYQSRLGNRLFDLDLGPATLAFAGASTAQDQRDIDA
VLAAASTSTPSASTPFAAAWLRHRSLDWAADLLRDFPGPAPGAAPIPSHSQENLP
 
Nucleotide Sequence: 2478 bp     [Download]
>gi|187927112|ref|NC_010682.1|:2761212-2763689 Ralstonia pickettii 12J chromosome 1, complete sequence
ATGCTGAACCTTGCCGAATACCGCCAGCGCCCGGCCTTGCTGGCTGACTGGCTGCCTTGGGCCGGGCTGA
TCGCTCCGGGCGTCGTGCTGAATAAGGATGGCTCCTTCCAGCGCACGGCGCGCTTTCGGGGGCCAGACCT
CGACAGTGCCACGCAGGGCGAGCTGATCTCTACGTCAGCACGGTTGAACAACGCGCTGCGCAGGCTGGGT
TCGGGCTGGGCCTTGTTCATCGAAGCCGAGCGCCGGCCCGCCGCCAACTACCCGCACTCGGAGTTTCCCG
AGCCGCTGTCGTGGCTGGTGGACGAGGAGCGACGGGCCGCCTTTGAGGACTTGGGCAATCACTTCGAGAG
CGGCTACCACCTCACGCTGGTGTACCTGCCGCCCGAGGAGGCCCGTGCCCGTGCCGCGGGCCTGCTGTAC
GAGAACCGGCTGACCGAAGGCGTCGATTGGCGCGAGCGCCTGACTGCCTTCATCGCGGAGACGGAACGCA
TCTTTGACCTGCTCGACGGCGTGATGCCGGAGATCGCCTGGCTCGACGATAGCCAGACGCTGACCTACCT
GCACGCCACCGTGTCTACACGGCGTTACCGCGTGGGCGTGCCCGAGGTGCCATTCCACCTCGATGCGCTG
CTGGCCGACGCGCCGCTGATCGGTGGCTTGGCGCCGATGCTGGGCGACCAGCACCTGCGCGTGGTGTCGG
TGCGCGGTTTTCCGATCTCGACTTGGCCGGGGATTCTGGACGACCTCAACCGTCTGGGCTTCGCGTATCG
CTGGAGTACGCGCTTTCTCTGCCTGGACAAAGCCGAGGCGGAAAAAGAACTCGCCCGCCTGCGCCGTCAG
TGGTTCGCCAAACGCAAGAACGTCATCGCGCTGCTGCGCGAGACGATCTTCCAGCAGGAAAGCCCGCTGG
TCGATACCGACGCCAGCAACAAGGCCACCGATGCCGATGCCGCCTTGCAGGAGCTGGGCAGCGATCAAGT
GGCCTTCGGCTACGTGACAGCGACCGTCACCGTCATGGACGCGGATGCCGCCGTGGCCAACGAGAAGCTG
CGCAGGGTGGAGCGCGTCATCCAGGGGCGTGGCTTCGTCACCATCCCCGAAACGCTCAACGCCGTGGATG
CGTGGCTGTCGTCCATTCCGGGCCATGCCTACGCCAACGTCCGCCAGCCCATCGTCTCCACGTTGAACCT
GGCGCACCTGATGCCGGTGTCGGCGGTATGGGCCGGGCCGGAGAAGAACGCGCACCTCGACGGCCCGCCG
CTGATCGTCACGCGCACTGAGGGCGCGACGCCGTTCCGGCTGGTGACGCACATCGGCGACGTGGGCCACA
CGCTGGTGGCTGGCCCTACGGGCATGGGCAAGTCGGTGCTGCTCGCCACCTTGGCGATGCAGTTTCGGCG
CTATCGCGGCTCGCGCATCTTTGCCTTCGACATGGGGCGCTCGATGCGCGCCACCATCCTCGGGCTGGGT
GGTGAGCACTACGACCTCGGGATGGATGGCGAGATCGCGTTTCAGCCTCTCGCCCGCATCGACCGCGAGG
GCTACCGCACCTGGGCCGCCGAATGGATCGAAGGGCGCTTGCGGCATGAGAGCGTGGCCGTCGGCCCCGA
AGAGAAGGCCGCTATCTGGTCGGCGCTCGGCAGTCTCGCCGGTGCGCCGATGGAACAGCGCACGATGACG
GGCCTGTCGGTACTGCTGCAATCGAATGCGCTGCGCCAGGCGCTTGCGCCGTACGTGCTGGGCGGCGCCC
ACGGCAAGCTGCTGGATGCGGATTCGGATCGCCTGGGCGCTGGCTCCGTGCAGTGCTTCGAGATGGAGGA
ATTGATGCACAGCAAGGCCGCCGTCATGGCCGTGCTGCACTACCTCTTTGCGCGCTTCGATGAGCGCTTT
GACGGTGCGCCCACGCTGCTGATCCTCGATGAAGCCTGGCTGTTCCTCGATGACCCGGTGTTTGCCGCGC
GCATTCGCCAGTGGCTCAAGACGTTGCGCAAGAAGAACGTGTCGGTCATCTTCGCCACGCAGAGCCTGGC
CGACATCAAGGATTCGAGCATCGCGCCCGCGATCATCGAAAGCTGCGCGAGCCGCATCTTCCTGCCGAAC
CCGCAGGCGACCGAGCCGCAGATTCGCACGATCTACGAAGGCTTTGGGCTGAACTTGCGCCAGATCGAGA
TCGTCGCCACCGCGCAGCCCAAGCGCGACTACTACTACCAATCCCGCCTCGGCAATCGCCTGTTCGACCT
CGACCTGGGACCGGCGACGCTGGCCTTCGCGGGCGCATCCACGGCGCAGGACCAGCGCGACATCGACGCG
GTGCTCGCTGCCGCCAGCACCTCCACACCTTCCGCTTCCACCCCGTTCGCAGCCGCATGGCTGCGCCACC
GCAGCCTCGATTGGGCGGCCGATCTGCTGCGCGATTTCCCCGGCCCCGCGCCGGGTGCCGCCCCCATCCC
CAGCCATTCCCAGGAGAACCTGCCATGA
 Primer design