SecReT4
Protein ID: 187929720
T4SS name [ID]Trb [330]
Gene symbol-
Locus tagRpic_2649
StrainRalstonia pickettii 12J
Repliconchromosome 1 [GenBank: NC_010682] [Browse all T4SS(s) in this replicon]
Location [Strand]2763686..2764441 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDB2UAH8
KEGG IDrpi:Rpic_2649
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 251 a.a.     [Download]
>gi|187929720|ref|YP_001900207.1| conjugal transfer protein TrbJ [Ralstonia pickettii 12J]
MKPHAHNLAALTTACVLAFGIAQPAHALFGVGDIVFDPTNLVQNTLTAVRTLEQINNQIRQLQNEAQMLI
NQARNLASLPSSVVGQLRANLATTQRLIAQAKGMAYDVANMDQMFQRLYPEQYSATVSGNQMYRDAQERW
KNTLTGLQTTMQMQAQASQNLSDDEGVLADLVGKSQSAVGALQAMQAMNQLLALQAKQSIQTQRLQITQD
RAASLELARQAAAVERGREVNRRFVGTGTPYTPQPVNFYSR
 
Nucleotide Sequence: 756 bp     [Download]
>gi|187927112|ref|NC_010682.1|:2763686-2764441 Ralstonia pickettii 12J chromosome 1, complete sequence
ATGAAACCCCATGCCCACAATCTCGCCGCGCTGACCACCGCCTGCGTGCTCGCCTTCGGCATTGCGCAGC
CCGCGCATGCACTGTTCGGCGTTGGCGACATCGTGTTCGATCCGACCAATTTGGTGCAGAACACGCTCAC
CGCCGTTCGCACGCTGGAGCAGATCAACAACCAGATCCGCCAGCTCCAAAACGAAGCGCAGATGCTCATC
AACCAGGCGCGCAACCTGGCCAGCCTGCCGTCCAGCGTGGTGGGCCAGCTGCGCGCCAACCTGGCGACCA
CCCAGCGGCTCATCGCCCAGGCCAAGGGCATGGCCTACGACGTGGCGAACATGGACCAGATGTTCCAGCG
TCTGTACCCCGAACAGTACTCCGCCACCGTCAGCGGCAATCAGATGTACCGCGATGCGCAGGAGCGCTGG
AAGAACACGCTCACTGGCCTTCAGACCACCATGCAGATGCAGGCCCAGGCTTCGCAGAACCTGAGCGATG
ACGAGGGCGTGCTGGCCGACCTCGTGGGCAAGAGCCAGTCCGCCGTGGGCGCTCTCCAGGCGATGCAGGC
CATGAACCAGTTGCTGGCCCTGCAGGCCAAGCAGTCCATTCAGACCCAGCGCTTGCAGATCACGCAGGAC
CGCGCGGCCTCGCTGGAGCTGGCGCGGCAGGCCGCCGCAGTGGAGCGTGGCCGCGAGGTGAATCGGCGCT
TCGTGGGCACTGGCACGCCGTACACGCCGCAGCCCGTGAACTTCTACAGCCGCTGA
 Primer design