SecReT4
Protein ID: 187929721
T4SS name [ID]Trb [330]
Gene symbol-
Locus tagRpic_2650
StrainRalstonia pickettii 12J
Repliconchromosome 1 [GenBank: NC_010682] [Browse all T4SS(s) in this replicon]
Location [Strand]2764454..2765806 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB2UAH9
KEGG IDrpi:Rpic_2650
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.7e-48, Aligned region: 37..264
Protein Sequence: 450 a.a.     [Download]
>gi|187929721|ref|YP_001900208.1| conjugal transfer protein TrbL [Ralstonia pickettii 12J]
MNDVSVIDRFLDVFSRYIDSGFGLVQGEVAFLTATLIVIDMTLAGLFWAMGHATGQGEDVIAKLIRKVLY
VGAFAYIIGNFNTLAGILFRSFAGLGLTASGSTLSMGNFLQPGRLAKAGIDAAAPILDQIREMAGFPEVF
INIAPIVVLFLAWLVVIVSFFVLAVQLFVTLIEFKLTTLAGFVLVPFALWNKTAFLVEKVLGNVVSSGIK
VLVLAVIVGIGSGLFAEFQVQPAEPSIDHSVVVMLASLTLLALGIFGPGIATGLVSGGPQLGAGAMAGAA
LGAAGAAVAVGAAATGVGGAVAAGARMAPAAAKLAGSGARAATGAASSARSAFQAGSASAGGGLKGAAAG
VGNVAKTGAQAAGQKVAYGARSMKERMAAAFRPDDAGSASGAGAAQAANEPTPSTEQPAWAKRLHRRQQL
THAATTAAHTLRGGDGGSSSQGPSLRDSES
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|187927112|ref|NC_010682.1|:2764454-2765806 Ralstonia pickettii 12J chromosome 1, complete sequence
ATGAACGACGTTTCGGTCATCGACCGCTTCCTCGACGTTTTCTCGCGCTACATCGACTCGGGATTCGGCC
TGGTGCAGGGCGAGGTGGCGTTCCTGACCGCAACGTTGATCGTCATCGACATGACGTTGGCCGGGCTGTT
CTGGGCGATGGGGCATGCCACCGGCCAGGGCGAGGACGTGATCGCCAAGCTGATCCGCAAGGTGCTATAC
GTGGGTGCTTTCGCCTACATCATCGGCAACTTCAACACCCTGGCGGGCATCCTGTTCCGTTCCTTCGCCG
GGCTGGGCCTGACGGCCAGCGGCTCGACCTTGAGCATGGGCAACTTCCTGCAGCCGGGACGGCTGGCCAA
GGCCGGCATCGACGCGGCGGCGCCCATCCTCGACCAGATCCGGGAGATGGCGGGCTTCCCCGAGGTGTTC
ATCAATATCGCGCCCATCGTCGTGCTGTTCCTCGCGTGGCTGGTGGTCATCGTCAGCTTCTTCGTGCTGG
CGGTGCAGCTCTTCGTCACGCTGATCGAGTTCAAGCTGACCACGCTCGCGGGCTTCGTGCTCGTGCCGTT
CGCCCTCTGGAACAAGACGGCGTTCCTAGTCGAGAAGGTGTTGGGCAATGTGGTGTCGTCCGGCATCAAG
GTGCTGGTGCTGGCGGTGATCGTGGGCATTGGTTCGGGGCTGTTCGCGGAGTTTCAGGTACAGCCCGCCG
AGCCATCCATCGACCACTCCGTGGTCGTGATGCTGGCCTCGCTGACGCTGCTGGCCTTGGGCATTTTCGG
GCCGGGCATTGCGACCGGGCTGGTGTCCGGCGGGCCGCAACTCGGCGCGGGTGCGATGGCCGGTGCGGCG
CTGGGCGCGGCCGGCGCTGCCGTTGCCGTGGGCGCTGCGGCCACGGGCGTCGGCGGCGCAGTCGCCGCCG
GGGCGCGCATGGCGCCCGCAGCCGCCAAGCTGGCCGGTAGCGGAGCGCGTGCCGCCACCGGAGCCGCGAG
CAGCGCCCGGTCAGCGTTTCAGGCAGGTTCTGCATCCGCCGGCGGTGGCCTCAAGGGCGCTGCCGCCGGC
GTGGGCAATGTCGCCAAGACCGGCGCGCAGGCGGCCGGGCAGAAGGTGGCCTATGGCGCGCGTTCGATGA
AGGAGCGCATGGCGGCGGCCTTTCGACCCGACGACGCCGGATCGGCGTCTGGGGCCGGTGCCGCCCAGGC
GGCAAACGAGCCAACCCCATCCACCGAACAACCCGCCTGGGCCAAGCGCCTGCACCGCAGGCAGCAACTC
ACCCATGCCGCTACGACCGCCGCCCACACGCTGCGCGGCGGCGATGGCGGCAGCTCCAGCCAGGGGCCAA
GCCTGCGCGATTCCGAATCCTGA
 Primer design