SecReT4
Protein ID: 187929722
T4SS name [ID]Trb [330]
Gene symbol-
Locus tagRpic_2651
StrainRalstonia pickettii 12J
Repliconchromosome 1 [GenBank: NC_010682] [Browse all T4SS(s) in this replicon]
Location [Strand]2765825..2766529 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDB2UAI0
KEGG IDrpi:Rpic_2651
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.1e-61, Aligned region: 23..225
Protein Sequence: 234 a.a.     [Download]
>gi|187929722|ref|YP_001900209.1| conjugal transfer protein TrbF [Ralstonia pickettii 12J]
MRFKRPQVRYADTPQPATPYQSAAQVWDERIGSARVQARNWRFMAFGCLTLAVLMAGGLVWRSAQSIVTP
YVIEVDNAGQVRAVGEAATPYRPSDAQIAYHLGRFIGLVRSLSIDPIVVRQNWLDAYDYTTDKGAVVLNE
YARVNDPFARIGKESVTVQITSVTRASDTSFNVRWTETRFVNGALDRTERWNAVVSIVQQTPRTEQRLRK
NPLGIYVNGLSWSRELEGNEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|187927112|ref|NC_010682.1|:2765825-2766529 Ralstonia pickettii 12J chromosome 1, complete sequence
ATGCGATTCAAACGACCGCAGGTGCGCTACGCCGACACGCCGCAGCCTGCCACCCCGTACCAATCCGCCG
CGCAAGTCTGGGACGAGCGCATCGGCTCGGCCCGCGTGCAGGCTAGAAACTGGCGTTTCATGGCCTTTGG
CTGCCTCACCTTGGCCGTGCTGATGGCCGGTGGTCTGGTCTGGCGCTCCGCGCAATCCATCGTCACGCCC
TACGTCATCGAGGTGGATAACGCGGGCCAGGTGCGCGCGGTCGGCGAGGCCGCCACGCCGTACCGGCCCA
GCGATGCGCAGATCGCCTACCACCTGGGCCGCTTCATCGGCCTGGTGCGCAGCCTGTCCATCGACCCCAT
CGTGGTGCGGCAGAACTGGCTCGATGCCTACGACTACACGACCGACAAGGGCGCTGTTGTGCTCAACGAG
TACGCCCGCGTGAACGATCCGTTCGCGCGCATCGGCAAGGAGTCAGTGACGGTGCAGATCACCAGCGTGA
CCCGCGCCAGTGACACGTCTTTCAACGTGCGCTGGACGGAGACGCGCTTCGTCAATGGCGCGCTGGATCG
CACCGAACGCTGGAACGCCGTGGTTTCCATCGTGCAGCAGACGCCGCGCACCGAGCAGCGCCTGCGCAAG
AACCCCCTGGGCATCTACGTCAACGGCCTGTCGTGGAGCCGCGAACTGGAAGGAAACGAAGGAGCAAAAC
CATGA
 Primer design