SecReT4
Protein ID: 187929723
T4SS name [ID]Trb [330]
Gene symbol-
Locus tagRpic_2652
StrainRalstonia pickettii 12J
Repliconchromosome 1 [GenBank: NC_010682] [Browse all T4SS(s) in this replicon]
Location [Strand]2766526..2767521 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDB2UAI1
KEGG IDrpi:Rpic_2652
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2e-67, Aligned region: 104..323
Protein Sequence: 331 a.a.     [Download]
>gi|187929723|ref|YP_001900210.1| P-type conjugative transfer protein TrbG [Ralstonia pickettii 12J]
MNDLFRKSVLPVMLLASTVLFSGCATQGKPPPTISLDEPVQAQPLPEPPAPVEVVTVPQVLPMPAQMKSV
PDAKPTPEPADETVRVSRANAEARIAPTREGYVNAIQVWPFTDGALYQVYAAVGRVTVIALQPGEELVTV
AAGDTVRWIVGDTSSGSGDALRVNVMVKPIRSGLKTNLVITTSRRTYLLELTSTEKTWMASVSWEYPKDK
MLALQRQSQAASAAAPVDTGLSLEKIRFRYAVSGSNPPWKPLRAFDDGEKVYIQFPPGIAQGELPPLFVI
GAQGDGQLVNYRFRPPYYIVDRLFGAAELRLGGDGGDVVRIERTDGVARRN
 
Nucleotide Sequence: 996 bp     [Download]
>gi|187927112|ref|NC_010682.1|:2766526-2767521 Ralstonia pickettii 12J chromosome 1, complete sequence
ATGAATGATCTTTTCCGTAAATCCGTCTTGCCGGTGATGCTTCTGGCTTCGACCGTGCTGTTCTCTGGCT
GCGCCACGCAGGGCAAGCCGCCGCCGACCATTTCGCTTGATGAGCCGGTACAGGCCCAGCCGCTGCCAGA
GCCGCCTGCGCCTGTGGAGGTGGTGACCGTGCCGCAGGTGCTGCCGATGCCGGCGCAGATGAAAAGTGTG
CCGGATGCCAAGCCCACGCCGGAACCCGCCGATGAAACCGTGCGCGTGTCCCGCGCCAATGCCGAAGCGC
GCATTGCACCGACGCGCGAGGGCTACGTCAACGCAATTCAAGTCTGGCCCTTCACGGACGGCGCGCTGTA
TCAGGTCTATGCGGCCGTAGGCCGCGTGACGGTAATCGCGCTCCAGCCCGGTGAGGAGCTGGTGACGGTG
GCGGCGGGCGACACGGTACGCTGGATCGTCGGGGACACATCGAGCGGCAGCGGTGATGCGCTGCGCGTCA
ATGTGATGGTCAAGCCGATCCGCTCGGGGTTGAAGACGAATCTGGTCATCACCACCAGCCGGCGCACCTA
CCTGCTGGAACTGACATCGACAGAGAAGACGTGGATGGCGTCGGTGTCCTGGGAATATCCCAAGGACAAG
ATGCTGGCCTTGCAGCGCCAGTCGCAGGCGGCCAGCGCCGCCGCGCCGGTCGATACCGGCCTGTCGCTGG
AGAAGATCCGCTTCCGCTACGCCGTGTCGGGCAGCAATCCGCCGTGGAAGCCGCTGCGCGCCTTCGATGA
CGGCGAGAAGGTCTATATCCAGTTCCCGCCGGGCATCGCGCAAGGCGAGTTGCCGCCCTTGTTCGTGATC
GGCGCGCAGGGCGACGGGCAACTGGTGAACTACCGTTTCCGCCCGCCGTACTACATCGTGGATCGGCTGT
TCGGCGCGGCCGAACTGCGCCTGGGCGGTGATGGCGGTGACGTGGTGCGGATCGAGCGCACGGATGGCGT
GGCGCGGAGGAACTGA
 Primer design