SecReT4
Protein ID: 187929724
T4SS name [ID]Trb [330]
Gene symbol-
Locus tagRpic_2653
StrainRalstonia pickettii 12J
Repliconchromosome 1 [GenBank: NC_010682] [Browse all T4SS(s) in this replicon]
Location [Strand]2767524..2768795 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDB2UAI2
KEGG IDrpi:Rpic_2653
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.2e-57, Aligned region: 227..409
Protein Sequence: 423 a.a.     [Download]
>gi|187929724|ref|YP_001900211.1| conjugation TrbI family protein [Ralstonia pickettii 12J]
MSQDDTPDLAAPQAGKVAPEAVALRAQPRPVTRLNRRTLAILVGGLSVAVLGATIWSLQPHRRGAGEQTE
LYNVDRVSKSEGLDGLPADYSKLPPKVPELGPPLPGDLGPAIVKSQQPVTPTYAPPGHDPEDARRKEADA
AAGSSVFFRSGNQGKAAAPGTAQAAAVAPGSALAGFDPLAAGPASTAAQPADPTAVQNRQDQKEAFLKGG
STETRNSGNLQMPVSPYQVMAGTVIAGALVTGIKSDLPGDVIVTVTEPVYDTATGKFLLIPQGSRILGKY
NSQVSYGQSRVQVVWNRVILPDTSSLKLDNLAGTDPAGYAGLEDGVDWHWDRVFAGAALTTLLGVGAELA
APENRQNGNRIVIAGRDSAQDSINQVGQEMIRRNMNIQPTLTERPGLPVRIIVNRDLVLRPYQPLFFNRG
AMR
 
Nucleotide Sequence: 1272 bp     [Download]
>gi|187927112|ref|NC_010682.1|:2767524-2768795 Ralstonia pickettii 12J chromosome 1, complete sequence
ATGAGCCAGGACGACACTCCTGACCTCGCCGCGCCGCAGGCGGGCAAGGTAGCACCCGAGGCGGTGGCGC
TGCGCGCCCAGCCGCGTCCGGTCACACGCTTGAACCGGCGCACGCTGGCCATCCTCGTCGGCGGCCTGTC
GGTCGCCGTGCTGGGGGCCACGATCTGGTCATTGCAGCCGCATCGGCGTGGCGCGGGCGAGCAGACCGAG
CTGTACAACGTCGATCGCGTGTCGAAGTCCGAAGGGCTGGATGGCCTGCCGGCCGACTACTCGAAGCTGC
CGCCGAAGGTGCCCGAGCTGGGGCCGCCGCTGCCGGGCGATCTCGGCCCGGCCATCGTGAAGTCGCAGCA
GCCGGTGACGCCGACGTATGCGCCACCGGGGCACGACCCGGAGGATGCACGGCGCAAGGAGGCTGATGCG
GCGGCGGGTTCGTCGGTGTTCTTCCGCTCGGGCAACCAGGGCAAGGCCGCCGCACCGGGAACAGCGCAAG
CCGCTGCGGTTGCGCCTGGCAGCGCCTTGGCCGGCTTCGACCCGCTGGCCGCCGGGCCAGCCTCGACGGC
GGCCCAGCCTGCCGACCCCACCGCGGTGCAGAACCGGCAAGACCAGAAAGAGGCGTTCCTGAAAGGCGGT
TCTACGGAAACCCGCAACTCCGGCAATCTGCAAATGCCGGTCTCGCCGTATCAGGTCATGGCGGGAACGG
TGATCGCCGGGGCGCTGGTGACGGGCATCAAGTCGGACTTGCCGGGCGACGTGATCGTCACGGTGACGGA
GCCGGTCTACGACACGGCCACGGGCAAGTTTCTGCTGATCCCCCAAGGCTCGCGCATCCTGGGCAAATAC
AACAGCCAGGTGAGCTACGGGCAGAGCCGCGTGCAGGTGGTGTGGAACCGCGTCATCCTGCCGGACACGT
CTTCGCTGAAGCTCGACAACCTCGCGGGCACCGACCCGGCCGGTTACGCCGGCCTGGAGGATGGCGTCGA
TTGGCACTGGGATCGCGTCTTCGCGGGTGCGGCGTTGACCACGTTGCTGGGCGTGGGTGCCGAGTTGGCC
GCGCCGGAGAACCGGCAGAACGGCAACCGGATCGTGATCGCCGGACGCGACAGCGCGCAGGACAGCATCA
ACCAGGTCGGCCAGGAGATGATCCGGCGCAACATGAACATCCAGCCGACGCTGACCGAACGGCCGGGCCT
GCCGGTGCGGATCATCGTCAATCGCGATCTGGTGTTGCGGCCGTACCAGCCACTGTTCTTCAATCGGGGT
GCAATGCGATGA
 Primer design