SecReT4
Protein ID: 187930881
T4SS name [ID]Trb [783]
Gene symbol-
Locus tagRpic_5007
StrainRalstonia pickettii 12J
Repliconplasmid pRPIC01 [GenBank: NC_010683] [Browse all T4SS(s) in this replicon]
Location [Strand]54459..55802 [-]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDB2UKI7
KEGG IDrpi:Rpic_5007
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.5e-46, Aligned region: 250..432
Protein Sequence: 447 a.a.     [Download]
>gi|187930881|ref|YP_001901367.1| conjugation TrbI family protein [Ralstonia pickettii 12J]
MATPDRNAAPMTNEPAPRVRVRRGLAKTISIFFGATILSIVFVRYFTHPRETADQRARREQLEQLAKEQP
ASGDALAQKLENQFTRAQTEHPAPVAPAAPKTPPSGPVPNGMVGGASSPAGLPGGAPGFQEGLTPEQRLA
LQRASQENDAMAVVSYGDREQGAAASAGTNPISDYIAALQRQHADKRTAPGEAGTPAIQAQLAALAAANS
QSQNTPGSATNARHVAWQGQQTNQGQSATLTPQAAESPFMVMPGTPIPVVLNQGVNSDMPGQYSATVDRD
IYDSISGSCRLIAKGTRIVGASNSDVAIGQERMQMGAALMIFRNGASMVLDGLNGADPNGEAGVSADVNN
HFFKIFGSTFLIAGIAQYIGRNQSQPTGTTLNINGGGGATGLTSAAGQAVSQTTQTILQRNSNIQPTLRL
DPGQKLVFITKAPIRIPPNTVAGECYQ
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|187930822|ref|NC_010683.1|:c55802-54459 Ralstonia pickettii 12J plasmid pRPIC01, complete sequence
ATGGCCACGCCTGACCGCAATGCGGCCCCCATGACCAATGAGCCTGCCCCGCGCGTTCGCGTGCGGCGGG
GGCTGGCCAAGACGATCTCCATTTTCTTCGGTGCCACGATTCTGTCGATCGTGTTCGTGCGCTATTTCAC
GCACCCGCGTGAAACAGCTGACCAACGGGCACGGCGCGAGCAGCTCGAACAATTGGCGAAGGAACAGCCG
GCTTCGGGAGATGCGCTTGCTCAGAAGCTGGAGAATCAATTCACGCGAGCCCAGACCGAGCATCCGGCAC
CCGTGGCGCCGGCGGCGCCGAAGACGCCGCCATCCGGCCCGGTGCCGAACGGCATGGTAGGCGGCGCGTC
TTCGCCGGCCGGCCTTCCTGGGGGAGCGCCTGGTTTCCAGGAAGGGCTGACCCCGGAGCAGCGACTGGCC
CTGCAGCGAGCCTCCCAGGAAAATGACGCGATGGCGGTAGTGTCCTATGGCGATCGCGAGCAAGGCGCGG
CAGCCAGTGCCGGCACCAATCCGATCTCCGATTACATCGCGGCGCTGCAGCGTCAACACGCCGACAAACG
TACCGCGCCTGGTGAAGCTGGGACACCTGCCATTCAAGCGCAGCTTGCCGCGCTTGCGGCGGCCAACAGC
CAGAGCCAGAACACGCCCGGTTCCGCAACGAACGCGCGTCACGTCGCGTGGCAAGGACAGCAGACGAACC
AAGGCCAGAGTGCAACGTTGACCCCGCAAGCCGCCGAATCGCCATTCATGGTTATGCCGGGCACGCCCAT
CCCGGTTGTGCTCAACCAAGGCGTCAACAGCGACATGCCCGGGCAGTACAGCGCGACCGTCGACCGGGAC
ATCTACGACAGCATCAGTGGCTCATGCCGATTGATCGCAAAAGGCACTCGGATCGTCGGGGCGAGCAATA
GCGATGTAGCGATCGGGCAGGAGCGTATGCAGATGGGCGCCGCGCTCATGATCTTCCGTAACGGCGCATC
GATGGTGCTCGATGGGTTGAACGGAGCCGATCCGAACGGTGAAGCCGGCGTGTCGGCCGACGTCAACAAT
CACTTCTTCAAGATTTTTGGCTCCACGTTCCTGATCGCTGGCATCGCCCAATACATCGGCCGCAATCAAA
GCCAGCCAACCGGCACCACGCTCAACATCAATGGCGGCGGCGGTGCCACCGGCTTGACCTCTGCTGCCGG
CCAGGCGGTCTCGCAGACCACGCAGACCATCCTGCAGCGCAACTCCAACATCCAGCCGACATTGCGGCTC
GATCCTGGCCAAAAGCTCGTTTTCATCACGAAAGCGCCGATCCGAATTCCACCTAACACCGTTGCTGGAG
AGTGCTACCAATGA
 Primer design