SecReT4
Protein ID: 187930882
T4SS name [ID]Trb [783]
Gene symbol-
Locus tagRpic_5008
StrainRalstonia pickettii 12J
Repliconplasmid pRPIC01 [GenBank: NC_010683] [Browse all T4SS(s) in this replicon]
Location [Strand]55802..56755 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDB2UKI8
KEGG IDrpi:Rpic_5008
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 7.5e-46, Aligned region: 66..294
Protein Sequence: 317 a.a.     [Download]
>gi|187930882|ref|YP_001901368.1| conjugal transfer protein TrbG [Ralstonia pickettii 12J]
MKTLPRAILIIAAMATHAASVYADVPAAAPRPQGEFGRMSKVAPAARAASPCAKSSAFGPFAEQQDPTLA
TYAYDADYTYPIPMRPNQQTHLVLGDDETLVSFTLGDRNKKLWPTMPSVTKRDLFIVPAAAGQRAAATII
TSKRRYELQLCSGDDGPAYQRVSWQYTDTLADGVGASPTAFGFEMAATPGVPGRPEAGGSKTGSPRIDAT
RMNTNYRIEGNAEFKPVMVFDDGRMTYYQLPHDAKLSAVFILDKDGQGEMARVIPLGNDMYQIQEVVTYG
ALLKRGKDEVRIFNGKGSGCGFFSCDTKPVKNIDGGA
 
Nucleotide Sequence: 954 bp     [Download]
>gi|187930822|ref|NC_010683.1|:c56755-55802 Ralstonia pickettii 12J plasmid pRPIC01, complete sequence
ATGAAGACGCTACCTCGCGCCATTCTCATCATTGCTGCGATGGCAACGCATGCCGCATCGGTCTATGCCG
ATGTCCCTGCAGCCGCTCCTCGCCCCCAGGGCGAGTTCGGCCGCATGTCGAAGGTTGCGCCGGCAGCTCG
CGCGGCGTCGCCCTGCGCCAAGTCTTCTGCTTTCGGCCCCTTTGCTGAGCAGCAAGACCCGACGCTTGCG
ACCTACGCCTACGACGCGGATTACACATATCCGATTCCGATGCGGCCCAATCAGCAGACGCACCTGGTGC
TGGGTGACGACGAGACGTTGGTGTCGTTCACGCTCGGCGACCGAAACAAGAAGCTCTGGCCAACGATGCC
ATCGGTCACCAAGCGCGACCTCTTCATCGTGCCGGCTGCAGCTGGACAGCGCGCGGCCGCGACGATCATC
ACGTCGAAACGACGCTACGAGCTTCAACTGTGCTCGGGTGACGACGGCCCGGCATATCAACGTGTGAGTT
GGCAATACACAGACACGTTGGCCGATGGTGTCGGCGCGAGCCCGACGGCATTCGGTTTCGAGATGGCGGC
TACGCCTGGTGTACCAGGTCGCCCAGAAGCGGGAGGCTCGAAAACGGGGAGCCCGCGCATCGACGCGACG
CGCATGAACACGAACTACCGCATCGAGGGCAACGCCGAGTTCAAGCCGGTGATGGTGTTCGACGATGGCC
GCATGACGTATTACCAACTGCCGCACGACGCCAAGCTGTCGGCCGTGTTCATCCTGGACAAGGATGGCCA
GGGTGAAATGGCGCGCGTGATTCCGCTCGGCAACGACATGTACCAGATCCAGGAGGTTGTCACGTACGGC
GCGCTGCTCAAGCGAGGCAAGGACGAGGTGCGGATCTTCAATGGCAAGGGGTCAGGCTGTGGTTTCTTCA
GCTGCGATACTAAGCCTGTGAAGAACATCGATGGGGGCGCTTGA
 Primer design