SecReT4
Protein ID: 187930883
T4SS name [ID]Trb [783]
Gene symbol-
Locus tagRpic_5009
StrainRalstonia pickettii 12J
Repliconplasmid pRPIC01 [GenBank: NC_010683] [Browse all T4SS(s) in this replicon]
Location [Strand]56752..57480 [-]
Producthypothetical protein
Component typeTrbF
UniProt IDB2UKI9
KEGG IDrpi:Rpic_5009
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.3e-30, Aligned region: 25..232
Protein Sequence: 242 a.a.     [Download]
>gi|187930883|ref|YP_001901369.1| hypothetical protein Rpic_5009 [Ralstonia pickettii 12J]
MKFSSSRSTPEMQITPPPGTGQGVRGWFAAFQKPILDKHLATKVAIVFAAISIGQTVAIVRISDNSGPKP
YFVERDKQSGAVYYSEKYAEAFTPTADNNAYFLRKWATRVFTINLDAQDTLKRQIPLARTWTSGAATKEL
DTYITETDPVAQRVVNTPGLTRQFEDNSISFSADGNIAYMIVTLTESIAGVRQTPKQKLLTINFLTAPQQ
LKPEDRKDNPIGMRITGLSITPYTGITPGSTK
 
Nucleotide Sequence: 729 bp     [Download]
>gi|187930822|ref|NC_010683.1|:c57480-56752 Ralstonia pickettii 12J plasmid pRPIC01, complete sequence
ATGAAATTTTCCTCCTCCAGATCCACCCCTGAAATGCAAATTACTCCGCCGCCCGGAACTGGCCAGGGCG
TCCGTGGATGGTTTGCTGCGTTTCAGAAACCAATTCTCGACAAGCACCTGGCAACGAAAGTCGCCATTGT
GTTCGCGGCTATCTCCATCGGGCAGACCGTCGCGATCGTCCGAATTAGCGATAACTCTGGCCCGAAGCCC
TATTTCGTCGAACGCGACAAGCAAAGCGGTGCCGTCTACTACAGCGAGAAATACGCCGAGGCGTTCACCC
CGACCGCCGACAACAACGCCTATTTCCTGCGCAAGTGGGCTACCCGCGTATTCACGATCAACCTGGATGC
GCAAGACACCCTGAAGCGACAGATCCCGCTTGCACGCACGTGGACCTCCGGTGCCGCAACCAAGGAGCTC
GACACCTACATCACTGAAACCGATCCGGTGGCCCAGCGCGTCGTCAACACGCCCGGGCTGACCCGTCAGT
TCGAAGACAACTCCATATCGTTCTCGGCCGACGGCAACATCGCCTACATGATCGTCACTCTGACCGAGAG
CATTGCCGGCGTTCGCCAGACGCCCAAGCAGAAGCTGCTCACCATCAACTTCCTCACCGCGCCGCAACAA
CTCAAGCCGGAAGACAGGAAGGACAACCCGATCGGCATGCGCATCACGGGCCTGTCCATTACTCCGTACA
CCGGCATTACCCCAGGATCGACGAAATGA
 Primer design