SecReT4
Protein ID: 187930884
T4SS name [ID]Trb [783]
Gene symbol-
Locus tagRpic_5010
StrainRalstonia pickettii 12J
Repliconplasmid pRPIC01 [GenBank: NC_010683] [Browse all T4SS(s) in this replicon]
Location [Strand]57480..58496 [-]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeTrbL
UniProt IDB2UKJ0
KEGG IDrpi:Rpic_5010
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 9.3e-18, Aligned region: 40..310
Protein Sequence: 338 a.a.     [Download]
>gi|187930884|ref|YP_001901370.1| TrbL/VirB6 plasmid conjugal transfer protein [Ralstonia pickettii 12J]
MDDILSTINQLFAAVQSAGSSLENLFVSDGIDLLAALGLIVATWHTLLWLLDGDFPNYFSMMLRHVVKVA
VLLLILTTWSGTVHSYFVSNMQTMADRVAGGSADSNTLANTLVGAIQTVMSGTRTQSHTVCTDVPDYTLD
GGIPTGTSHQDCHDVNDNALDNTSFWTAFKTLPVVLLTLLAKAIALIAMVLCVLIFVVVVQMGSILLHIA
FCLGPILVPWFVFPPTEFLFENWLRAVIGAGLYKVIAWIMMGLVMKGVVPGFNALLQKVAATNGVGSEIY
YNTAYLALIALALVASIGAFLMWQVPAIASTYAGGGGASLKGFGKGAISKMAQGNGAS
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|187930822|ref|NC_010683.1|:c58496-57480 Ralstonia pickettii 12J plasmid pRPIC01, complete sequence
ATGGATGACATCCTCAGCACAATCAACCAACTGTTCGCCGCCGTACAAAGTGCGGGCTCATCTCTCGAAA
ACCTCTTTGTTTCTGACGGCATCGACTTGCTTGCGGCGCTTGGATTGATCGTCGCGACCTGGCACACCTT
GCTGTGGCTGCTCGATGGTGATTTTCCGAACTACTTCTCGATGATGTTGCGCCACGTCGTCAAGGTCGCG
GTACTCCTCCTGATCCTCACCACCTGGTCAGGCACGGTGCACAGCTACTTCGTGAGCAACATGCAAACCA
TGGCCGATCGCGTCGCCGGTGGCAGTGCCGACTCGAATACGCTCGCCAACACCCTGGTCGGCGCCATCCA
GACGGTCATGTCCGGCACGCGCACCCAATCGCACACAGTCTGTACCGATGTCCCGGATTACACGCTGGAC
GGCGGCATTCCTACTGGCACCAGCCACCAGGATTGTCATGACGTCAACGACAACGCATTGGACAACACCA
GTTTCTGGACAGCCTTCAAAACGTTGCCAGTTGTGCTGCTCACGCTTCTCGCAAAGGCCATCGCTCTGAT
CGCCATGGTGCTCTGCGTGCTGATCTTCGTTGTGGTCGTGCAAATGGGCTCGATCCTGCTTCACATCGCC
TTTTGCCTTGGTCCCATTCTTGTGCCCTGGTTCGTCTTCCCGCCAACGGAATTTCTCTTCGAGAACTGGT
TGAGAGCCGTCATTGGCGCAGGCCTCTACAAGGTCATCGCCTGGATCATGATGGGCCTCGTCATGAAGGG
CGTTGTGCCTGGCTTCAATGCCTTGCTGCAGAAGGTCGCCGCGACCAACGGCGTCGGCAGCGAGATCTAC
TACAACACGGCCTATCTGGCCCTGATCGCCCTCGCCCTCGTCGCCTCGATCGGCGCGTTCTTGATGTGGC
AGGTCCCGGCAATCGCCAGCACGTACGCCGGCGGCGGCGGAGCTTCGCTCAAGGGCTTTGGCAAAGGCGC
TATTTCGAAGATGGCACAAGGTAACGGAGCATCCTGA
 Primer design