SecReT4
Protein ID: 187930886
T4SS name [ID]Trb [783]
Gene symbol-
Locus tagRpic_5012
StrainRalstonia pickettii 12J
Repliconplasmid pRPIC01 [GenBank: NC_010683] [Browse all T4SS(s) in this replicon]
Location [Strand]58869..59780 [-]
Producthypothetical protein
Component typeTrbJ
UniProt IDB2UKJ2
KEGG IDrpi:Rpic_5012
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 303 a.a.     [Download]
>gi|187930886|ref|YP_001901372.1| hypothetical protein Rpic_5012 [Ralstonia pickettii 12J]
MHKTFIRNDIEVRVFAAPKALEPETRKQYEELSLTSAEVNAVKASRIARTAKRAAAALALCTSASAFAGS
VAGFGGATEITQLLNNAELVSSVAQQAQMVEQNIQAQITRLQNLAQVPGELINETIAPYTQQLDNFRSLY
SAVTDLQQAAQSTSQLFSNAMSDMSSANLKPSQWLSALSSLAKSQGGVYRAQLNQDLNAISSLAKRAQNL
QSIQSKIPGVTGNVQGLQMLNQQTNVLAGEMIDLHALMQRQVAMQMQDKADQSQNRDNVAQLLKARSAQA
ADINTKEQTMIQNAPAFQLPRDQ
 
Nucleotide Sequence: 912 bp     [Download]
>gi|187930822|ref|NC_010683.1|:c59780-58869 Ralstonia pickettii 12J plasmid pRPIC01, complete sequence
ATGCATAAGACCTTCATTCGCAATGACATCGAGGTGCGCGTATTTGCTGCCCCCAAGGCACTCGAACCCG
AAACCCGGAAGCAGTACGAAGAACTCAGCTTGACCTCCGCTGAGGTGAATGCAGTCAAGGCCTCGCGTAT
TGCCCGCACGGCGAAGCGCGCGGCCGCAGCGCTCGCGCTCTGCACGTCAGCTTCGGCATTCGCCGGCAGC
GTGGCTGGCTTCGGCGGCGCGACCGAGATTACGCAGTTGCTCAACAACGCCGAACTGGTGTCCTCGGTTG
CCCAGCAAGCCCAGATGGTCGAGCAGAACATCCAGGCGCAAATCACCCGGCTGCAAAACCTCGCCCAGGT
GCCGGGCGAGCTCATCAACGAGACCATCGCGCCCTACACCCAGCAGCTCGACAACTTCCGGTCCCTCTAC
TCGGCCGTGACGGACCTGCAACAAGCGGCCCAGTCCACCAGCCAGTTGTTCAGCAATGCCATGTCGGACA
TGAGCTCGGCCAACTTGAAGCCGTCGCAGTGGCTGTCGGCGCTGTCGTCACTCGCGAAATCGCAAGGCGG
CGTGTACCGGGCACAACTCAACCAGGACTTGAATGCCATCAGCTCGCTGGCCAAACGTGCTCAGAACCTG
CAAAGCATCCAATCCAAGATCCCAGGCGTCACCGGCAACGTTCAGGGGCTGCAGATGCTGAATCAGCAAA
CCAACGTCCTGGCCGGCGAAATGATCGATCTGCATGCCCTCATGCAGCGACAAGTCGCCATGCAGATGCA
AGACAAGGCGGACCAGTCGCAGAACCGCGACAACGTGGCACAGCTGCTCAAAGCTCGCTCGGCACAGGCT
GCGGACATCAATACGAAGGAACAAACCATGATCCAGAACGCCCCGGCATTCCAACTGCCGCGCGATCAAT
AA
 Primer design