SecReT4
Protein ID: 187930887
T4SS name [ID]Trb [783]
Gene symbol-
Locus tagRpic_5013
StrainRalstonia pickettii 12J
Repliconplasmid pRPIC01 [GenBank: NC_010683] [Browse all T4SS(s) in this replicon]
Location [Strand]59773..62451 [-]
ProductType IV secretory pathway VirB4 protein-like protein
Component typeTrbE
UniProt IDB2UKJ3
KEGG IDrpi:Rpic_5013
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 9.3e-24, Aligned region: 515..807
Protein Sequence: 892 a.a.     [Download]
>gi|187930887|ref|YP_001901373.1| Type IV secretory pathway VirB4 protein-like protein [Ralstonia pickettii 12J]
MLNNPTLSPFDRESLTQIEERLAGRRRSTAELVPWLFKYSDFMIANKDSALMVSFEFTAPDSNSISMTVM
RELYEHVAASLGNLSRYPISLWWTVHRRLDSRYVTLPMPDKVAQMVDDDRHANFLAEGNYVNRHFVTFSL
LPQVGLDAFASRVMHGVTHDDLSIPSALWEAVRATFSDQYQFAYTQSELEAAVETFESILHGFAADNPHI
KMRRLAGKRLGGFMHAVCSPPSDHITELDIPETPALDQAMCDTEITPGHDYLHFYSNGRQRYGIATGIPG
KRDYWPSNASPKTLDDLLKIKGELTISHCFRVSSPSAAKRFIDSIRKYHEGQRFDVRQLLAATLRGTDMD
AKPGRQNKTRLKAAEEANTRAGKVEMLEEIYGFYNFTVIAYSPVFEETPASKGLAGEQAYKKAVATHNAV
EDVLRAAQFIPVRETLHAMSAFATTIPGMWRECARWAFLDTEAVSRLLPLRGVSRGSMFNAHLSKQMRTR
IPALAAFTTEYGTPFWFTAYLMDLGHMLICGRSGFGKTIFMLLCATLFRKYPNARLIGFDMNLSMRIPTV
LQGGRYLQFAADANTVAEEERATCNPYVLLGHLRHLKFLVDWTVLLASQRGYRPTTDDRKAIEKAIRAAA
TRDPQFWRLRFVHASLPNGPLKNELDQWVGEAVDALYFDNEQDGFDDTQWTSIATDKILKDHAVARPFLS
YATYRIQDEIEQRRLRGVIAPTVVMLPEIWSLLDDNQFAKQIGEWIVTMRKLLGCVWMDAQTPEQVANSP
IWPAIRDNVLIRVFVPVKDFKPDTKKAYEEKFGLTQTQQDAIKKLKAKRDYFITEDGGISRSVSVPLPPR
TEAILRSELQAQILFDRHMRSGEPDWKERYIEEATAQIEADKLNLDDEDRHA
 
Nucleotide Sequence: 2679 bp     [Download]
>gi|187930822|ref|NC_010683.1|:c62451-59773 Ralstonia pickettii 12J plasmid pRPIC01, complete sequence
GTGCTGAACAACCCTACGCTCTCGCCGTTCGACCGAGAATCGCTTACACAGATCGAGGAACGCCTAGCAG
GCCGGAGGCGATCGACCGCTGAGCTCGTGCCGTGGCTATTCAAGTACAGCGATTTCATGATCGCCAACAA
GGATTCAGCCTTGATGGTGTCCTTTGAATTCACGGCACCTGATTCCAACAGCATTTCCATGACGGTGATG
CGTGAACTTTACGAGCACGTCGCCGCCAGCCTGGGCAACCTGTCGCGCTATCCTATCTCGCTCTGGTGGA
CGGTCCATCGGCGCTTGGATTCGCGCTATGTCACCCTGCCCATGCCGGACAAGGTTGCGCAGATGGTCGA
CGACGATCGGCACGCGAATTTCTTGGCCGAAGGCAACTACGTCAACCGGCATTTCGTCACGTTCTCGCTT
CTTCCCCAGGTCGGGCTCGACGCATTCGCCTCGCGCGTCATGCATGGCGTTACGCATGACGACCTGTCGA
TCCCGAGCGCGCTCTGGGAGGCCGTGCGTGCCACGTTTTCCGACCAGTACCAGTTCGCCTACACGCAGTC
CGAACTGGAGGCTGCTGTTGAAACCTTTGAATCTATCCTGCACGGCTTCGCTGCAGACAACCCGCACATC
AAAATGCGGCGTCTGGCCGGCAAGCGCCTCGGCGGATTTATGCACGCGGTCTGCTCCCCGCCAAGCGATC
ACATCACTGAACTGGACATCCCGGAAACGCCGGCACTCGACCAGGCGATGTGCGACACGGAAATTACGCC
GGGCCACGACTACCTGCACTTCTACTCGAACGGGCGCCAGCGATACGGCATTGCAACGGGGATTCCGGGG
AAGCGGGACTACTGGCCAAGCAATGCGTCGCCAAAGACTCTGGACGACCTCCTGAAGATCAAGGGTGAGC
TCACCATCAGCCATTGCTTCCGTGTGTCGTCACCCAGCGCAGCAAAGCGTTTCATCGACAGTATCCGCAA
GTACCACGAAGGCCAGCGCTTCGATGTGCGCCAGCTGCTCGCGGCGACCCTGCGCGGGACTGATATGGAC
GCCAAGCCAGGGCGCCAGAACAAAACGCGCCTGAAGGCCGCCGAAGAGGCGAACACACGCGCCGGCAAGG
TCGAAATGCTTGAGGAGATCTACGGCTTCTACAACTTCACCGTCATTGCGTACTCGCCCGTGTTCGAGGA
AACGCCGGCCTCGAAGGGTCTTGCCGGCGAGCAGGCCTACAAGAAAGCCGTGGCGACACACAACGCCGTG
GAAGACGTTCTGCGCGCAGCCCAGTTCATACCGGTGCGCGAGACTCTGCACGCCATGTCGGCGTTTGCGA
CCACCATTCCGGGTATGTGGCGCGAGTGCGCGCGCTGGGCGTTTCTCGACACCGAAGCCGTTTCCCGCTT
GCTGCCGCTGCGCGGCGTCTCGCGCGGCTCAATGTTCAATGCGCATCTGTCCAAGCAGATGCGCACACGG
ATTCCGGCGCTGGCGGCGTTTACCACCGAATACGGTACGCCTTTCTGGTTTACCGCCTACCTGATGGACC
TTGGCCACATGCTCATCTGTGGCCGCTCGGGCTTCGGCAAGACCATCTTCATGTTGCTGTGCGCGACACT
GTTCCGGAAATATCCGAACGCGCGGCTGATCGGCTTCGACATGAATTTGTCGATGCGCATTCCGACTGTC
CTGCAGGGTGGGCGCTATCTGCAATTTGCGGCCGATGCCAACACCGTGGCCGAAGAGGAGCGGGCAACCT
GCAATCCCTATGTCCTGCTGGGTCATCTCCGCCATCTCAAGTTCCTAGTCGACTGGACCGTGCTGCTGGC
CAGCCAGCGAGGCTATCGGCCCACCACGGACGATCGAAAAGCCATCGAGAAGGCGATACGCGCAGCTGCT
ACGCGCGACCCTCAATTCTGGCGTCTGCGGTTCGTGCACGCCTCCCTGCCCAATGGCCCGCTGAAAAACG
AGCTTGACCAGTGGGTGGGCGAGGCGGTCGACGCGCTCTACTTCGATAACGAACAAGACGGTTTCGACGA
CACGCAGTGGACCTCGATTGCAACGGACAAGATCCTCAAGGATCACGCCGTTGCGCGCCCGTTCCTCTCC
TACGCGACCTACCGTATTCAGGACGAAATCGAGCAACGCCGGTTGCGCGGGGTCATCGCGCCAACCGTCG
TCATGCTCCCGGAAATCTGGTCGCTGCTCGATGACAACCAGTTCGCCAAGCAGATCGGTGAATGGATCGT
GACCATGCGCAAGCTGCTCGGTTGCGTTTGGATGGACGCACAGACCCCCGAACAAGTCGCCAACTCACCG
ATTTGGCCCGCCATCCGCGACAACGTTCTGATCCGCGTCTTCGTGCCCGTCAAGGATTTCAAGCCGGATA
CCAAGAAGGCCTACGAGGAAAAGTTTGGTCTCACGCAGACCCAGCAGGACGCGATCAAGAAGCTCAAGGC
CAAGCGCGACTACTTCATTACCGAGGACGGCGGGATCTCCCGCAGCGTCTCAGTTCCCCTGCCTCCGCGC
ACGGAGGCCATCCTGCGCTCCGAACTGCAGGCGCAGATCCTCTTCGATCGGCATATGCGTTCCGGTGAGC
CGGACTGGAAGGAGCGCTACATCGAGGAGGCCACTGCACAGATCGAAGCCGACAAACTCAACCTAGACGA
TGAGGACCGCCATGCATAA
 Primer design