SecReT4
Protein ID: 187930888
T4SS name [ID]Trb [783]
Gene symbol-
Locus tagRpic_5014
StrainRalstonia pickettii 12J
Repliconplasmid pRPIC01 [GenBank: NC_010683] [Browse all T4SS(s) in this replicon]
Location [Strand]62445..62801 [-]
Producttype IV secretory pathway VirB3 family protein
Component typeTrbD
UniProt IDB2UKJ4
KEGG IDrpi:Rpic_5014
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.1e-07, Aligned region: 17..97
Protein Sequence: 118 a.a.     [Download]
>gi|187930888|ref|YP_001901374.1| type IV secretory pathway VirB3 family protein [Ralstonia pickettii 12J]
MTTAIEAGTPAADTPADSLSVPIRKTMLEKFLMGGIDRKLCAGELAILIFTAVGLRNPWVLLALPPTHLI
LWLATKRDPDQFNCYLRYSKQGDFYEPRPMLRQTRNARPKGFARGELC
 
Nucleotide Sequence: 357 bp     [Download]
>gi|187930822|ref|NC_010683.1|:c62801-62445 Ralstonia pickettii 12J plasmid pRPIC01, complete sequence
ATGACTACCGCGATCGAAGCCGGCACGCCGGCGGCGGATACGCCCGCCGACTCCCTGTCCGTGCCCATCC
GCAAGACCATGCTCGAAAAGTTCCTGATGGGGGGCATTGACAGGAAGCTCTGCGCCGGCGAGCTCGCCAT
CCTCATATTCACCGCCGTAGGCCTGCGCAATCCGTGGGTCCTGCTGGCGCTTCCGCCGACGCATCTGATC
CTGTGGCTCGCGACGAAACGCGATCCTGACCAATTCAACTGCTATTTGCGCTACAGCAAACAGGGCGACT
TCTACGAGCCGCGGCCGATGCTTCGCCAGACACGTAATGCTCGCCCCAAGGGCTTCGCGCGAGGTGAACT
GTGCTGA
 Primer design