SecReT4
Protein ID: 187930890
T4SS name [ID]Trb [783]
Gene symbol-
Locus tagRpic_5016
StrainRalstonia pickettii 12J
Repliconplasmid pRPIC01 [GenBank: NC_010683] [Browse all T4SS(s) in this replicon]
Location [Strand]63241..64272 [-]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDB2UKJ6
KEGG IDrpi:Rpic_5016
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.5e-64, Aligned region: 21..305
Protein Sequence: 343 a.a.     [Download]
>gi|187930890|ref|YP_001901376.1| type II secretion system protein E [Ralstonia pickettii 12J]
MNDQQTRGFAFEVLHDYLRDLQEMMADPETNEIMINRHDVVYRERRGVMERIEGLAIAPAALDTAITVLT
NINDKDQAPLLDARLPGLRIAAARFPVSIHGDMMSIRKHSVRRIALDDYVRNGAFAVLPASQNRFIGRQD
RTVLDHAAEGGEALMRCLQWIMRQRYNIVFSGGTSSGKTTLLNALLEAIPESDRIVTIEDTAELKIALPN
FVSFEANQNITIRNLIKFALRIRPDRIFVGEVRGAEAFDLVEALNTGHDGSICTLHATSADEAPYKLESY
IRMSEEGRLIATEDLRKKIASTFRFFLHADRQGDGTRGPVELREVLGVEDGRYKTRLLFSRFA
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|187930822|ref|NC_010683.1|:c64272-63241 Ralstonia pickettii 12J plasmid pRPIC01, complete sequence
ATGAATGACCAGCAGACACGTGGTTTCGCGTTCGAGGTCCTCCATGACTACCTGCGTGATCTGCAGGAAA
TGATGGCAGACCCGGAAACCAACGAAATCATGATCAACCGCCACGATGTCGTGTACCGCGAGCGGCGCGG
TGTGATGGAGCGCATCGAAGGGCTGGCGATCGCGCCTGCCGCGCTCGATACCGCCATCACGGTTCTGACC
AATATCAACGACAAGGATCAGGCGCCGCTGCTCGATGCGCGCCTGCCAGGCCTGCGCATCGCAGCCGCCC
GATTCCCCGTGTCAATCCACGGCGACATGATGTCGATCCGCAAGCACTCCGTGCGGCGCATCGCCTTGGA
TGATTACGTGCGCAACGGTGCTTTCGCCGTGTTGCCCGCCTCGCAGAACCGCTTCATCGGCCGGCAGGAT
CGGACTGTTCTCGACCACGCCGCTGAAGGCGGCGAGGCGTTGATGCGCTGCCTGCAATGGATCATGCGCC
AGCGCTACAACATTGTGTTCTCCGGCGGCACCTCATCCGGCAAGACCACCCTGCTCAATGCGTTGCTCGA
AGCGATTCCGGAATCCGATCGCATTGTCACCATCGAGGACACCGCCGAACTGAAGATCGCTTTGCCCAAC
TTCGTGTCGTTCGAAGCGAACCAGAACATCACGATTCGCAATCTCATTAAGTTCGCACTGCGCATTCGGC
CCGACCGCATCTTTGTGGGCGAGGTCCGGGGCGCCGAGGCCTTCGACCTGGTGGAAGCACTGAACACCGG
GCATGACGGCTCGATTTGCACACTGCACGCCACGAGCGCGGATGAAGCGCCCTACAAGTTGGAGTCGTAC
ATCCGCATGAGCGAGGAAGGCCGCCTGATCGCCACCGAGGATCTGCGCAAAAAGATCGCCTCGACCTTCC
GCTTCTTCTTGCATGCCGATCGACAAGGTGATGGCACGCGCGGGCCTGTTGAGCTCCGCGAAGTGCTGGG
CGTTGAGGACGGCCGCTACAAGACACGCCTTTTGTTTTCCCGTTTCGCCTAA
 Primer design