SecReT4
Protein ID: 187930891
T4SS name [ID]Trb [783]
Gene symbol-
Locus tagRpic_5017
StrainRalstonia pickettii 12J
Repliconplasmid pRPIC01 [GenBank: NC_010683] [Browse all T4SS(s) in this replicon]
Location [Strand]64265..64816 [-]
Productlytic transglycosylase
Component typeTrbN
UniProt IDB2UKJ7
KEGG IDrpi:Rpic_5017
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 183 a.a.     [Download]
>gi|187930891|ref|YP_001901377.1| lytic transglycosylase [Ralstonia pickettii 12J]
MKGSAFLLVMALLPALAFADCIDEAARFHQVDARLVRAIAQVESRMHADAVGANSDGSTDIGLMQINSSW
LPSLARYGITRAHLFDACVNAYVGSWILSRNIQQLGLTWDAVGAYNAKSPAKRLAYAQKVYQALATASST
PSRAIANPVASVRPVEAPRAAARRRQTNTSSDITIVSWEPPNE
 
Nucleotide Sequence: 552 bp     [Download]
>gi|187930822|ref|NC_010683.1|:c64816-64265 Ralstonia pickettii 12J plasmid pRPIC01, complete sequence
ATGAAGGGCTCTGCATTCCTGCTCGTCATGGCGCTATTGCCGGCGCTGGCCTTTGCCGACTGTATTGACG
AAGCCGCCAGGTTCCACCAGGTCGATGCGCGCTTGGTGCGCGCCATCGCCCAGGTGGAGTCGCGGATGCA
CGCGGACGCCGTTGGCGCCAACAGCGATGGCAGTACCGACATCGGTCTCATGCAGATCAACTCAAGCTGG
CTACCCAGCCTGGCGCGCTATGGCATCACCCGAGCGCATCTGTTTGATGCTTGTGTCAACGCCTACGTAG
GAAGTTGGATTCTGTCTCGCAATATCCAGCAGCTCGGCCTCACGTGGGATGCCGTCGGGGCCTACAACGC
CAAGAGCCCGGCAAAGCGTCTCGCCTACGCGCAAAAGGTCTATCAGGCGTTGGCGACGGCCAGCTCTACG
CCGAGCCGCGCAATTGCCAACCCAGTAGCCTCAGTACGGCCTGTGGAGGCGCCGCGTGCTGCTGCGCGCC
GCCGGCAGACGAACACGTCATCGGACATCACCATCGTCTCCTGGGAGCCACCCAATGAATGA
 Primer design