SecReT4
Protein ID: 188527609
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04155
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]808395..808742 [+]
Productcag pathogenicity island protein CagC
Component typeCagC
UniProt IDB2UTT4
KEGG IDhps:HPSH_04155
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 115 a.a.     [Download]
>gi|188527609|ref|YP_001910296.1| cag pathogenicity island protein CagC [Helicobacter pylori Shi470]
MKFLTRITDSYKKVVVTLGLVITTNPLMAVSSPAAGITETKSLVVQIISVLAIVGGCALGVKGIADIWKI
SDDIKRGQATVFAYAQPIAMLAVAGGIIYLSTKFGFNIGEGGGAS
 
Nucleotide Sequence: 348 bp     [Download]
>gi|209406223|ref|NC_010698.2|:808395-808742 Helicobacter pylori Shi470 chromosome, complete genome
ATGAAATTTCTTACAAGAATCACTGACAGCTACAAGAAAGTTGTAGTAACTTTAGGGCTAGTGATAACAA
CCAATCCTTTAATGGCGGTCAGCAGTCCTGCAGCAGGCATTACTGAGACTAAAAGTTTGGTTGTTCAGAT
CATTTCTGTTTTAGCGATCGTAGGTGGTTGCGCTCTAGGGGTCAAAGGCATAGCGGATATTTGGAAAATC
TCTGATGACATCAAAAGAGGTCAGGCGACTGTTTTTGCTTATGCACAGCCCATAGCTATGTTAGCGGTGG
CAGGCGGTATTATCTATTTGAGCACTAAGTTTGGCTTCAATATTGGCGAAGGTGGAGGAGCTAGCTAA
 Primer design