SecReT4
Protein ID: 188527610
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04160
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]808744..809367 [+]
Productcag pathogenicity island protein CagD
Component typeCagD
UniProt IDB2UTT5
KEGG IDhps:HPSH_04160
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 207 a.a.     [Download]
>gi|188527610|ref|YP_001910297.1| cag pathogenicity island protein CagD [Helicobacter pylori Shi470]
MINNNSNKKLRDFFLKVLLSLVVFSSYGSANDDNQAKKEALEKEKNTPSGRVYTNLDFDSFKATIKNLKD
KKVTFKEVNPDIIKDEVFDFVIVNRVLKKIKDLKHYDPIIEKIFDEKGKEMGLNVELQINPEVKDFFTFK
SISTTNKQRCFLSLHGETREILCDDKLYNVLLAVFNSYDPNDLLKHISTIESLKKIFYTITCEAVYL
 
Nucleotide Sequence: 624 bp     [Download]
>gi|209406223|ref|NC_010698.2|:808744-809367 Helicobacter pylori Shi470 chromosome, complete genome
TTGATCAACAATAATAGTAATAAAAAACTAAGAGACTTTTTTTTGAAAGTTCTCTTAAGTCTCGTTGTTT
TCAGTTCGTATGGGTCAGCAAATGATGATAATCAAGCGAAAAAAGAAGCGCTAGAAAAAGAAAAAAACAC
TCCTAGTGGGCGTGTTTATACGAATTTAGATTTTGATAGTTTCAAGGCGACTATCAAAAATTTGAAAGAC
AAGAAAGTAACTTTCAAAGAAGTCAATCCCGATATTATCAAAGATGAAGTTTTTGACTTCGTGATTGTCA
ATAGAGTCCTTAAAAAAATAAAGGATTTGAAGCATTACGATCCAATTATTGAAAAAATCTTTGATGAAAA
AGGTAAAGAAATGGGATTGAATGTAGAATTACAGATCAATCCTGAAGTGAAAGACTTTTTTACTTTCAAA
AGCATCAGCACGACCAACAAACAACGCTGCTTTCTGTCATTGCACGGAGAAACAAGAGAAATTCTATGCG
ATGATAAGCTATATAATGTTTTGTTGGCCGTATTCAATTCTTATGACCCTAATGATCTTTTGAAACATAT
TAGCACTATAGAGTCTCTCAAAAAAATCTTTTATACGATTACATGTGAAGCGGTATATCTATAA
 Primer design