SecReT4
Protein ID: 188527611
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04165
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]809382..812327 [+]
Productcag pathogenicity island protein CagE
Component typeCagE
UniProt IDB2UTT6
KEGG IDhps:HPSH_04165
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 4.3e-57, Aligned region: 324..529
AAA_10 [PF12846], Evalue: 4.4e-49, Aligned region: 589..904
AAA_23 [PF13476], Evalue: 1.5e-05, Aligned region: 582..979
Protein Sequence: 981 a.a.     [Download]
>gi|188527611|ref|YP_001910298.1| cag pathogenicity island protein CagE [Helicobacter pylori Shi470]
MASKQADEQKKLIIEQEVQKRQFQKIEELKADMQKGVNPFFKVLFDGGNRLFGFPETFIYSSIFILFVTI
VLSVILFQAYEPVLIVAIVIALVALGFKKDYRLYQRMERAMKFKKPFLFKGVKNKAFMSIFSMKPSKEMA
NDIHLNPNREDRLVSAANSYLANNYECFLDDGVILTNNYSLLGTIKLGGIDFLTTSKKDLIELHASIYSV
FRNFVTPEFKFYFHTVKKKIVIDETNRDYSLAFSNDFMRAYNEKQKRESFYDISFFLTIEQDLLDTLNEP
VMNKKHFADNNFEEFQRIIRAKLENFKDRIELIEELLSKYHPTRLKEYIKDGVVYSKQCEFYNFLVGMNE
APFICNRKDLYLKEKMHGGVKEVYFANKHGKILNDDLSEKYFSAIEISEYAPKSQSDLFDKINALDSEFI
FMHAYSPKNSQVLKDKLAFTSRRIIISGGSKEQGMTLGCLSELVGNGDITLGSYGNSLVLFADSFEKMKQ
SVKECVSSLNAKGFLANAATFSMENYFFAKHCSFITLPFIFDVTSNNFADFIAMRAMSFDGNQENNAWGN
SVMTLKSEINSPFYLNFHMPTDFGSASAGHTLILGSTGSGKTVFMSMTLNAMGQFAHNFPANVSKDKQKL
TMVYMDKDYGAYGNIVAMGGEYVKIELGTDTGLNPFAWAACVQKTNATMEQKQTAISVVKELVKNLATKS
DEKDENGNSISFSLADSNTLAAAVTNLITGDMNLDYPITQLINAFGKDHNDPNGLVARLAPFCKSTNGEF
QWLFDNKATDRLDFSKTIIGVDGSSFLDNNDVSPFICFYLFARIQEAMDGRRFVLDIDEAWKYLGDPKVA
YFVRDMLKTARKRNAIVRLATQSITDLLACPIADTIREQCPTKIFLRNDGGNLSDYQRLANVTEKEFEII
TKGLDRKILYKQDGSPSVIASFNLRGIPKEYLKILSTDTVFVKEIDKIIQNRSIIDKYQALRQMYQQIKE
Y
 
Nucleotide Sequence: 2946 bp     [Download]
>gi|209406223|ref|NC_010698.2|:809382-812327 Helicobacter pylori Shi470 chromosome, complete genome
GTGGCAAGCAAGCAAGCTGACGAACAAAAAAAGCTAATCATAGAGCAAGAGGTTCAAAAGCGGCAGTTTC
AAAAAATAGAAGAGCTTAAAGCAGACATGCAAAAAGGCGTCAATCCCTTTTTTAAAGTCTTGTTTGATGG
GGGGAATAGGTTGTTTGGTTTCCCTGAAACTTTTATTTATTCCTCTATATTTATATTGTTTGTAACAATT
GTATTATCTGTTATTCTTTTTCAAGCCTATGAACCTGTTTTGATTGTGGCGATTGTTATTGCGCTTGTAG
CTCTTGGATTCAAGAAAGATTATAGGCTTTATCAAAGAATGGAGCGAGCGATGAAATTTAAAAAACCTTT
TTTGTTTAAGGGCGTGAAAAACAAAGCATTCATGAGCATTTTTTCCATGAAGCCTAGTAAAGAAATGGCT
AATGACATCCACTTAAATCCAAACAGAGAAGACAGACTTGTGAGTGCTGCAAACTCCTATTTGGCGAATA
ACTATGAATGTTTTTTAGATGATGGGGTGATCCTTACTAACAACTATTCTCTTTTAGGCACAATCAAATT
GGGGGGCATTGATTTTTTAACCACTTCCAAAAAAGATCTCATAGAGTTACACGCTTCTATTTATAGCGTT
TTTAGGAATTTTGTTACCCCTGAATTCAAATTCTATTTTCACACTGTTAAAAAGAAAATCGTTATTGATG
AAACCAATAGGGACTATAGTCTTGCTTTTTCTAATGATTTTATGCGAGCCTATAATGAGAAGCAAAAGAG
AGAAAGTTTTTATGATATTAGTTTTTTTCTGACCATAGAGCAAGATTTATTAGACACTCTCAATGAACCT
GTTATGAATAAAAAGCATTTTGCAGACAATAATTTTGAAGAGTTTCAAAGGATTATTAGAGCCAAGCTTG
AAAACTTCAAGGATAGGATAGAGCTCATAGAAGAGCTATTGAGTAAATACCACCCCACTAGATTGAAAGA
ATATATTAAAGATGGGGTTGTTTATTCCAAACAATGCGAGTTTTACAATTTTCTTGTGGGAATGAATGAA
GCCCCTTTTATTTGCAACCGGAAAGATTTGTATCTGAAAGAGAAAATGCATGGTGGGGTGAAAGAAGTTT
ATTTTGCCAATAAGCATGGAAAAATCTTAAATGATGATTTGAGTGAAAAATATTTTAGCGCTATTGAGAT
TAGTGAATACGCCCCTAAATCACAGAGCGATTTGTTTGACAAGATCAACGCTCTAGACAGCGAATTTATC
TTTATGCATGCTTATTCGCCTAAAAACTCACAGGTTTTAAAGGATAAACTAGCTTTCACCTCTAGAAGGA
TTATTATTAGTGGAGGTTCTAAAGAGCAGGGCATGACTTTAGGTTGCTTGAGCGAATTAGTGGGTAATGG
TGATATTACGCTAGGCAGTTATGGTAATTCTTTAGTGCTGTTTGCTGATAGCTTTGAAAAAATGAAACAA
AGCGTCAAGGAATGTGTCTCTAGTCTTAACGCTAAAGGTTTTTTAGCCAACGCAGCGACTTTCTCTATGG
AAAATTACTTTTTTGCCAAACATTGCTCTTTTATTACGCTTCCTTTTATTTTTGATGTAACTTCTAATAA
TTTTGCTGATTTTATCGCTATGAGAGCGATGAGTTTTGATGGCAATCAAGAGAATAACGCTTGGGGTAAT
AGCGTCATGACGCTAAAAAGCGAGATCAATTCGCCTTTTTATCTGAACTTCCACATGCCTACTGATTTTG
GTTCAGCTTCAGCAGGACACACTTTGATACTTGGCTCAACCGGTTCAGGTAAGACAGTGTTTATGTCAAT
GACTCTAAACGCTATGGGACAATTTGCTCACAATTTTCCTGCTAATGTCAGCAAAGACAAGCAAAAGCTC
ACTATGGTCTATATGGATAAAGATTATGGCGCTTATGGGAATATTGTCGCAATGGGTGGGGAGTATGTCA
AAATTGAGCTAGGGACAGATACAGGATTAAACCCTTTTGCTTGGGCGGCTTGTGTGCAAAAAACAAATGC
AACAATGGAGCAAAAACAAACAGCTATTTCTGTTGTCAAAGAGCTTGTGAAAAACTTAGCAACCAAAAGC
GATGAAAAAGATGAAAATGGCAACAGTATCTCTTTTAGCCTAGCTGATTCTAATACGCTTGCAGCGGCAG
TAACCAACCTTATCACAGGAGATATGAACCTAGATTATCCCATCACTCAACTTATTAATGCTTTCGGAAA
AGACCACAATGATCCTAATGGGCTTGTCGCGCGATTAGCGCCTTTTTGTAAATCAACCAATGGTGAATTT
CAATGGCTTTTTGATAATAAAGCAACAGATCGCTTAGATTTTTCAAAAACGATTATTGGCGTTGATGGGT
CAAGTTTCCTAGACAATAATGATGTTTCGCCCTTTATTTGTTTTTACCTTTTCGCTCGTATTCAAGAGGC
AATGGATGGGCGTAGATTTGTCTTAGATATTGATGAAGCTTGGAAATATTTAGGCGATCCAAAGGTCGCT
TATTTTGTAAGAGACATGCTAAAAACTGCAAGGAAAAGAAACGCTATTGTTAGACTTGCAACTCAAAGCA
TCACTGATCTTTTGGCTTGCCCTATTGCTGATACTATTAGAGAACAATGCCCTACAAAGATTTTTTTGAG
AAACGATGGGGGCAATCTTTCTGATTACCAAAGATTAGCTAATGTTACAGAAAAAGAATTTGAAATCATC
ACTAAGGGGCTAGATAGGAAAATTCTCTACAAACAAGATGGAAGCCCTAGCGTTATCGCTAGTTTTAATT
TGAGAGGCATTCCTAAAGAATATTTGAAAATTTTATCCACAGATACTGTATTTGTCAAAGAAATTGACAA
GATTATACAAAATCGTAGTATCATAGATAAATATCAGGCCTTGAGGCAAATGTATCAACAAATAAAGGAG
TATTAA
 Primer design