SecReT4
Protein ID: 188527612
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04170
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]812329..813135 [+]
Productcag pathogenicity island protein CagF
Component typeCagF
UniProt IDB2UTT7
KEGG IDhps:HPSH_04170
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 268 a.a.     [Download]
>gi|188527612|ref|YP_001910299.1| cag pathogenicity island protein CagF [Helicobacter pylori Shi470]
MKQSLREQKLLKILENDVLTILDSFSNYLFELREELDFIEEEMEGEITEQNLTTLYDFSNFLEDHVNVFY
ENVLNIDDVKTEHLYSGLIDSLNANLHFVKSFLSNQDLDFRFFKEINDGQDPQKTLSRLIPLQSGKNDAS
SFKADNSFVSLVYVYVYFMLETIMQSYRILRLLEKPINNNIDEDMQSDIENFFVQANFLEYYVQNKIYPT
NHAYDFTHLIMDSIVPNWIQVDMSVEAKKKELFEKYFQNIDEVTNKMLDQKNQNKNSD
 
Nucleotide Sequence: 807 bp     [Download]
>gi|209406223|ref|NC_010698.2|:812329-813135 Helicobacter pylori Shi470 chromosome, complete genome
ATGAAACAAAGTTTGCGTGAACAAAAATTATTGAAAATTTTAGAAAATGATGTTTTGACGATTTTGGATA
GTTTTTCTAATTATCTTTTTGAACTGAGAGAAGAATTGGATTTCATAGAAGAAGAAATGGAAGGCGAAAT
CACTGAACAAAACCTTACCACTCTTTATGATTTTTCTAACTTCTTAGAAGACCATGTCAATGTGTTTTAT
GAGAATGTTTTAAATATAGATGATGTCAAAACAGAACACCTTTATTCAGGTCTCATAGATAGTCTCAATG
CTAATCTTCACTTTGTCAAGTCATTTCTCAGTAATCAGGATTTAGACTTCCGCTTTTTTAAAGAAATAAA
CGATGGGCAAGATCCCCAAAAAACACTATCAAGATTGATTCCTCTTCAAAGTGGGAAAAATGACGCAAGC
TCGTTTAAAGCAGATAATTCTTTTGTATCATTAGTTTATGTTTATGTTTACTTCATGCTAGAAACTATCA
TGCAGTCGTATAGGATTCTCAGGTTACTAGAAAAACCTATCAATAACAACATAGACGAGGATATGCAAAG
CGATATAGAGAATTTTTTTGTTCAAGCGAATTTTTTAGAATACTATGTTCAGAACAAAATATACCCAACA
AATCATGCCTATGACTTCACGCATTTAATCATGGACTCCATTGTTCCTAATTGGATTCAGGTTGATATGA
GCGTTGAAGCTAAAAAGAAAGAGCTTTTTGAAAAATATTTTCAAAACATTGATGAAGTAACAAACAAAAT
GCTCGATCAAAAAAATCAAAACAAAAATAGCGATTGA
 Primer design