SecReT4
Protein ID: 188527613
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04175
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]813190..813621 [+]
Productcag pathogenicity island protein CagG
Component typeCagG
UniProt IDB2UTT8
KEGG IDhps:HPSH_04175
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 143 a.a.     [Download]
>gi|188527613|ref|YP_001910300.1| cag pathogenicity island protein CagG [Helicobacter pylori Shi470]
MKTNFYKIKLLFAWCLIIGMFNAPLNADQNTDIKDISPEDMALNSVGLVSRDQLKIEIPKETLEQKVAIL
NDYNDKNVNIKFDDISLGSFQPNDNLGINAMWGIQNLLMSQMMGDYGPNNPFMYGYAPTYPDSSFLPPGL
GGY
 
Nucleotide Sequence: 432 bp     [Download]
>gi|209406223|ref|NC_010698.2|:813190-813621 Helicobacter pylori Shi470 chromosome, complete genome
ATGAAAACGAATTTTTATAAAATTAAATTACTATTTGCTTGGTGTCTTATCATTGGTATGTTTAACGCTC
CGCTTAACGCTGACCAAAACACTGATATAAAAGATATTAGTCCTGAAGATATGGCACTAAATAGCGTGGG
GCTTGTTTCTAGAGATCAACTAAAAATAGAGATCCCTAAAGAAACCCTAGAGCAAAAAGTGGCCATACTC
AATGACTATAATGATAAGAATGTTAATATCAAGTTTGATGACATAAGTTTAGGGAGTTTTCAACCTAATG
ATAATCTAGGTATCAATGCGATGTGGGGCATTCAAAATCTTCTCATGAGCCAAATGATGGGCGATTACGG
CCCAAACAATCCTTTCATGTATGGTTATGCACCAACATATCCAGATTCATCGTTTTTACCACCAGGCTTA
GGGGGGTATTAA
 Primer design