SecReT4
Protein ID: 188527615
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04185
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]813803..814735 [+]
Productcag pathogenicity island protein CagH
Component typeCagH
UniProt IDB2UTU0
KEGG IDhps:HPSH_04185
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 310 a.a.     [Download]
>gi|188527615|ref|YP_001910302.1| cag pathogenicity island protein CagH [Helicobacter pylori Shi470]
MTQYNQSIAEAVSMPMKAANQQYNQLYQGFNDQSMAVGNNILNISKLTGEFNAQGNTQGAQIGAVNSQIA
SILASNTTPKNPSAIEAYATNQIAVPSVPTTVEMMSGILGNITSAAPKYALALQEQLRSQASNSSMNDTA
DSLDSCTALGALASSSKVFFSCMQISMTPMSVSMPTVYAKYQALVANALTSGVNPMTTPACPTGDKVLVV
YCYAEKVAEILREYYIEFVKNNTNLLQNASQMILNQSGLATSTYDTQAISNISSLYNYNIVANKSFLKSH
LTYLDYIKDKLKGQKDSYLTERVQTKIIVK
 
Nucleotide Sequence: 933 bp     [Download]
>gi|209406223|ref|NC_010698.2|:813803-814735 Helicobacter pylori Shi470 chromosome, complete genome
ATGACCCAATACAATCAGAGCATCGCTGAAGCCGTAAGCATGCCTATGAAAGCCGCTAACCAACAATACA
ACCAATTGTATCAAGGTTTTAACGATCAAAGCATGGCTGTGGGGAATAATATCTTAAATATTAGCAAATT
AACAGGGGAATTTAATGCGCAAGGCAACACGCAAGGTGCGCAAATTGGTGCTGTTAATAGTCAGATTGCA
AGCATTTTAGCGAGTAACACTACCCCTAAAAATCCCAGTGCTATTGAAGCTTATGCGACGAATCAAATCG
CTGTTCCTAGTGTGCCAACAACGGTTGAAATGATGAGCGGTATCTTAGGCAATATTACAAGTGCAGCACC
AAAATACGCCCTAGCCCTACAAGAGCAACTGCGTTCTCAAGCAAGCAACAGCTCAATGAATGATACAGCC
GATTCCCTTGATAGCTGTACCGCTTTGGGTGCGCTTGCTAGCTCATCAAAAGTGTTTTTTAGTTGCATGC
AAATTTCTATGACTCCTATGAGTGTCTCTATGCCCACTGTTTATGCCAAATACCAAGCGTTAGTCGCTAA
TGCCCTAACTTCAGGCGTTAATCCTATGACCACTCCTGCATGCCCTACTGGGGACAAAGTTCTTGTCGTT
TATTGCTATGCTGAAAAGGTAGCAGAAATTTTGAGAGAATACTATATAGAATTTGTGAAAAACAATACCA
ATTTGTTGCAAAACGCTTCTCAAATGATACTTAATCAATCAGGATTAGCTACTAGCACCTATGACACTCA
AGCGATTTCTAACATAAGCTCGCTATATAACTACAATATAGTAGCGAATAAATCTTTTTTGAAATCGCAT
CTGACTTATCTTGATTACATCAAAGACAAACTTAAGGGGCAAAAAGATAGCTACTTAACAGAAAGGGTGC
AAACTAAAATAATCGTGAAGTGA
 Primer design