SecReT4
Protein ID: 188527616
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04190
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]814746..815885 [+]
Productcag pathogenicity island protein CagI
Component typeCagI
UniProt IDB2UTU1
KEGG IDhps:HPSH_04190
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 379 a.a.     [Download]
>gi|188527616|ref|YP_001910303.1| cag pathogenicity island protein CagI [Helicobacter pylori Shi470]
MKYFLSIFSFLTFLFLNGGEVVITLEPALKAIQADAQAKQKTAQAELKAIEAQSNAKEKAIQAQIEGELR
TQLATMSAMLKGANGVINGVNGMTGGFFAGSDILLAIMQGYSSALGALGGNVKMIVEKQKINTQTEIQNM
QIALQKNNEMIKLKMNQQNALLEALKNSFEPSVTLKTQMEMLSQALGSSSDNTKYIAYNTIGIKAFEETL
KGFETWLKVAMQKATLIDYNSLTGQALFQSTIYEPALSFFSSMGAPFGIIETFTLAPTKCPYLDGLKISA
CLMEQVIQNYRKIVALIQNKLNDADFQNIAYLNGINEEIKTLKGSVDLNALIEVAILNAENHLNYIENLE
KKADLWEEQLKLERETTARNIASSKVIVK
 
Nucleotide Sequence: 1140 bp     [Download]
>gi|209406223|ref|NC_010698.2|:814746-815885 Helicobacter pylori Shi470 chromosome, complete genome
GTGAAGTATTTTTTAAGCATATTTTCTTTCTTAACTTTTTTGTTTCTGAATGGTGGAGAGGTAGTAATAA
CGCTTGAACCTGCCTTAAAAGCCATTCAAGCGGATGCACAAGCCAAACAAAAAACCGCTCAAGCCGAATT
AAAAGCCATAGAGGCTCAATCTAATGCCAAAGAAAAAGCCATTCAAGCGCAAATAGAGGGAGAATTGAGG
ACTCAGCTTGCAACTATGAGCGCTATGTTAAAAGGGGCTAATGGCGTTATTAATGGTGTCAATGGCATGA
CAGGGGGGTTTTTTGCAGGTTCAGACATCTTGCTTGCCATCATGCAAGGGTATTCAAGCGCGCTTGGCGC
ATTGGGGGGAAATGTCAAAATGATCGTGGAAAAACAAAAAATTAATACCCAAACAGAAATCCAAAACATG
CAAATCGCGCTCCAAAAAAATAACGAAATGATCAAGCTCAAAATGAACCAGCAAAACGCTCTCTTAGAAG
CGTTAAAAAACAGCTTTGAACCGAGCGTTACCCTAAAAACACAAATGGAAATGCTTTCTCAAGCTCTAGG
AAGTTCTTCTGACAACACTAAATACATCGCTTACAATACGATTGGTATCAAGGCGTTTGAAGAAACCTTA
AAAGGTTTTGAAACATGGTTGAAAGTGGCTATGCAAAAAGCGACCCTTATTGACTACAATTCCCTAACAG
GTCAGGCTTTGTTTCAAAGCACCATCTACGAGCCTGCTCTTAGTTTTTTTTCAAGCATGGGCGCACCATT
TGGAATCATTGAAACATTTACTCTAGCACCCACAAAATGCCCCTATCTTGATGGGCTAAAAATTTCAGCA
TGCCTTATGGAACAGGTTATTCAGAATTACAGAAAGATTGTAGCCCTTATTCAAAATAAACTGAATGATG
CAGATTTTCAAAATATCGCTTATTTGAATGGGATCAATGAAGAAATCAAAACCTTAAAAGGATCAGTAGA
TTTGAATGCGCTCATAGAAGTTGCTATCTTAAACGCAGAAAATCATTTAAACTATATAGAGAATCTTGAA
AAAAAAGCCGACCTTTGGGAAGAACAACTGAAATTAGAGAGAGAAACGACAGCAAGAAACATTGCTAGCT
CTAAAGTTATTGTCAAATGA
 Primer design