SecReT4
Protein ID: 188527617
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04195
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]815882..816595 [+]
Productcag pathogenicity island protein CagL
Component typeCagL
UniProt IDB2UTU2
KEGG IDhps:HPSH_04195
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 237 a.a.     [Download]
>gi|188527617|ref|YP_001910304.1| cag pathogenicity island protein CagL [Helicobacter pylori Shi470]
MKTLVKNTISSFLLLSVLMAEDITSGLKQLDRTYKETNQQALKNLDEIFSTTSPSANDKIGTEDALNIKK
AAIALRGDLSLLKANFEANELFFISEDVIFKTYMSSPELLLTYMKINPLDQNTAEQQCGISDKVLVLYCE
GKLKIEQEKQNIRERLETSLKAYQSNIGGTTSLITASQTLVESLKNKNFIKGIRKLMLAHNKVFLNYLEK
LDALEISLEQSKRQYLQERQSSKIIVK
 
Nucleotide Sequence: 714 bp     [Download]
>gi|209406223|ref|NC_010698.2|:815882-816595 Helicobacter pylori Shi470 chromosome, complete genome
ATGAAAACACTCGTGAAAAATACCATATCTTCTTTTTTGCTATTGTCTGTTTTGATGGCAGAAGATATAA
CAAGCGGCTTAAAGCAACTTGATAGAACCTACAAAGAGACCAACCAACAAGCGCTCAAAAACTTAGATGA
GATTTTTTCAACCACTAGCCCTAGCGCTAATGATAAAATAGGTACAGAAGATGCTCTAAACATCAAAAAA
GCAGCCATTGCTTTGAGGGGAGATTTATCGTTATTGAAAGCCAATTTTGAAGCGAATGAGTTATTTTTCA
TCTCAGAAGATGTGATTTTCAAGACTTATATGTCTAGCCCTGAACTTTTATTAACCTATATGAAAATCAA
TCCCTTAGACCAAAACACTGCTGAGCAACAATGCGGAATATCCGATAAAGTTTTAGTTCTTTATTGTGAG
GGGAAGCTGAAAATCGAGCAAGAAAAACAAAATATAAGAGAGCGTTTAGAAACTTCTCTAAAGGCGTATC
AGAGCAACATTGGAGGTACAACTTCCTTAATCACTGCTTCACAGACGCTTGTAGAAAGCCTAAAGAATAA
AAATTTCATCAAAGGAATCAGAAAGCTTATGTTAGCTCACAACAAGGTCTTTTTAAATTATTTAGAGAAG
TTGGACGCATTAGAAATATCCCTAGAACAAAGTAAGCGACAATACCTACAAGAAAGGCAATCAAGTAAGA
TTATTGTTAAATGA
 Primer design