SecReT4
Protein ID: 188527618
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04200
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]816678..817598 [-]
Productcag pathogenicity island protein CagN
Component typeCagN
UniProt IDB2UTU3
KEGG IDhps:HPSH_04200
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 306 a.a.     [Download]
>gi|188527618|ref|YP_001910305.1| cag pathogenicity island protein CagN [Helicobacter pylori Shi470]
MKSIFKKLGSVALYFLVIYGGLNAINTALLPSEYKKLVALGFKKIKTLHQRHDDKEVTEEEKEFATNALR
EKLRNDRARAEQIQKNIEAFEKKNNSSIQKKATKHKGLQELNETNANPLNGNPNSNSSTETKSNKDDNFD
EMINKVNEAFVKPATPLVPNEWRTPEIETIINECILSSNDYDGLRKCLIKGIKDQKILAPLLEKIQEIET
ENNKFSRQHLSGLKLALNNSNNRTFLIASCAICEKRKKEMEQENNYQDTTNASEFGATDTKKNEAKDATF
SNNRSKSELPNSVINQIEQSIAHGKK
 
Nucleotide Sequence: 921 bp     [Download]
>gi|209406223|ref|NC_010698.2|:c817598-816678 Helicobacter pylori Shi470 chromosome, complete genome
TTGAAAAGTATCTTCAAAAAACTAGGTTCTGTCGCTCTTTATTTTTTAGTCATTTATGGGGGCTTAAACG
CTATCAATACAGCATTATTACCGAGTGAATACAAAAAATTAGTGGCTTTAGGCTTTAAAAAAATCAAAAC
ACTCCATCAAAGACATGACGACAAAGAAGTTACAGAAGAGGAAAAAGAATTCGCCACTAACGCTTTGAGA
GAAAAATTACGAAATGATAGGGCGAGAGCGGAGCAAATTCAAAAAAATATTGAAGCGTTTGAAAAAAAGA
ACAACTCTTCTATTCAAAAAAAAGCGACTAAGCACAAAGGATTACAAGAATTAAACGAAACTAACGCTAA
CCCTTTGAATGGCAATCCTAATAGTAATTCTTCCACTGAAACCAAATCTAATAAAGATGATAACTTTGAT
GAGATGATCAATAAGGTGAATGAAGCGTTTGTGAAACCTGCTACTCCGCTTGTGCCTAATGAGTGGAGAA
CACCTGAAATTGAAACCATTATCAATGAGTGTATTCTTTCAAGCAACGATTACGATGGGTTAAGAAAGTG
TTTGATCAAAGGCATCAAGGATCAAAAAATTCTTGCCCCCTTATTAGAAAAAATTCAAGAAATAGAGACA
GAAAATAACAAGTTTTCTAGACAACACTTGAGTGGTTTAAAGCTCGCTCTTAATAACAGCAACAATAGAA
CCTTTCTTATAGCTTCGTGTGCTATTTGTGAGAAGAGAAAAAAAGAAATGGAGCAAGAAAATAACTACCA
AGATACTACAAATGCAAGTGAGTTTGGGGCTACTGATACAAAAAAAAATGAAGCAAAAGATGCAACATTC
TCAAACAATCGCTCTAAATCTGAACTGCCCAATAGCGTCATTAATCAAATAGAACAAAGCATCGCTCATG
GAAAAAAATAG
 Primer design