SecReT4
Protein ID: 188527619
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04205
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]817613..818743 [-]
Productcag pathogenicity island protein CagM
Component typeCagM
UniProt IDB2UTU4
KEGG IDhps:HPSH_04205
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 376 a.a.     [Download]
>gi|188527619|ref|YP_001910306.1| cag pathogenicity island protein CagM [Helicobacter pylori Shi470]
MLAKIVFSSLVAFGVLSANVEQFGSFFNEIKKEQEEVAAKEDALKARKKLLNNTHDFLEDLIFRKQKIKE
LVDHRAKVLLDLENKYKKEKEALEKETRGKILTAKSKAYGDLEQALKDNSLYKKLLPNPYAYVLNQETFT
KEDKERLSYYYPQVKNSNIFKKTTATTKDKAQALLQMGVFSLDEEQNKKASRLALSYKQAIEEYSNNISN
LLSRKELDNIDYYLQLERNKFDSKAKDIAQKATNTLIFNSERLAFSMAIDKINEKYLKGYEAFSNLLKNV
KDDVELNTLTKNFTNQKLSFAQKQKLCLLVLDSFNFDTQSKKSILKKTNEYNIFVDSDPMMSDKTTMQKE
HYKIFNFFKTVLSAYRNNVAKNNPFE
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|209406223|ref|NC_010698.2|:c818743-817613 Helicobacter pylori Shi470 chromosome, complete genome
ATGCTTGCAAAAATCGTTTTTAGCTCATTGGTTGCGTTTGGAGTTTTGTCGGCTAATGTGGAGCAGTTTG
GTTCATTTTTCAACGAGATAAAAAAAGAACAAGAAGAGGTGGCTGCAAAAGAAGACGCTCTTAAGGCCCG
CAAAAAGCTCTTAAATAATACGCATGATTTCTTAGAAGACTTGATTTTTAGAAAACAAAAAATCAAAGAG
CTTGTGGATCATAGAGCTAAAGTTCTTTTAGATTTAGAAAACAAATACAAAAAAGAAAAAGAGGCTCTAG
AGAAAGAGACAAGAGGTAAAATCCTTACTGCTAAGTCAAAGGCTTATGGGGATCTAGAGCAAGCCTTAAA
AGATAACTCTCTCTATAAGAAACTTCTTCCTAACCCTTATGCCTATGTTTTAAACCAAGAAACATTCACC
AAAGAAGATAAGGAGCGTTTGAGCTATTACTACCCACAAGTCAAAAACAGCAACATTTTCAAAAAAACTA
CCGCTACCACTAAAGATAAGGCTCAGGCTTTGCTTCAAATGGGTGTGTTTTCTTTAGATGAAGAACAAAA
CAAAAAAGCGAGCCGATTAGCTTTATCTTACAAGCAAGCGATTGAAGAATATTCCAATAACATTTCTAAT
TTATTGAGCAGAAAAGAATTGGATAATATAGATTATTACTTACAGCTTGAAAGAAACAAGTTTGACTCCA
AAGCAAAAGATATCGCTCAAAAAGCTACTAACACGCTTATTTTTAACTCGGAACGCTTGGCGTTTAGCAT
GGCGATTGATAAGATCAATGAGAAATACTTAAAGGGTTATGAGGCTTTTTCTAACTTGTTGAAAAATGTC
AAAGATGATGTGGAATTGAATACTCTGACTAAAAACTTTACCAATCAAAAATTGAGTTTCGCTCAAAAAC
AAAAATTGTGTTTGTTGGTTTTAGACAGCTTCAATTTTGATACCCAATCCAAAAAATCTATATTAAAAAA
GACTAATGAATACAATATTTTCGTAGATAGCGATCCTATGATGAGTGACAAAACAACTATGCAAAAAGAA
CACTACAAGATATTTAATTTCTTCAAAACAGTGCTTTCTGCATACCGAAACAATGTTGCCAAGAATAATC
CCTTTGAATAG
 Primer design