SecReT4
Protein ID: 188527624
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04230
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]823876..824067 [+]
Productcag pathogenicity island protein CagC
Component typeCagC
UniProt IDB2UTU9
KEGG IDhps:HPSH_04230
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 63 a.a.     [Download]
>gi|188527624|ref|YP_001910311.1| cag pathogenicity island protein CagC [Helicobacter pylori Shi470]
MKFLTRITDSYKKVVVTLGLVITTNPLMAVSSPATGIGETKTLVVQIISVLAIVGGCAPFVYN
 
Nucleotide Sequence: 192 bp     [Download]
>gi|209406223|ref|NC_010698.2|:823876-824067 Helicobacter pylori Shi470 chromosome, complete genome
ATGAAATTTCTTACAAGAATCACTGACAGCTACAAGAAAGTTGTAGTAACTTTAGGGCTAGTGATAACAA
CCAATCCTTTAATGGCGGTCAGCAGTCCTGCAACAGGCATTGGTGAGACTAAAACTTTGGTTGTTCAGAT
CATTTCTGTTTTAGCGATCGTAGGTGGTTGCGCTCCTTTTGTCTATAACTAA
 Primer design