SecReT4
Protein ID: 188527630
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04260
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]826879..827721 [-]
Productcag pathogenicity island protein CagT
Component typeCagT
UniProt IDB2UTV5
KEGG IDhps:HPSH_04260
PDB IDNA
Domain hit(s) vs Pfam Cag12 [PF13117], Evalue: 4.4e-35, Aligned region: 12..123
Protein Sequence: 280 a.a.     [Download]
>gi|188527630|ref|YP_001910317.1| cag pathogenicity island protein CagT [Helicobacter pylori Shi470]
MKLRASVLIGAIILCLTLSACSNYAKKVVKQKNHVYTPVYNELIEKYSEIPLNDKLKDTPFMVQVKLPNY
KDYLLDNKQVVLTFKLVHHSKKITLIGDANKILQYKNYFQANGARSDIDFYLQPTLNQKGVVMIASNYND
NPNNKEQPQTFDVLQGSQPMLGANTKNLHGYDVSGANNKQVINEVAREKAQLEKINQYYKTLLQDKEQEY
TTRKNNQREILETLSNRAGYQMRQNVISSEIFKNGNLNMQSKEEEVREKLQEERENEYLRNQIRSLLSGK
 
Nucleotide Sequence: 843 bp     [Download]
>gi|209406223|ref|NC_010698.2|:c827721-826879 Helicobacter pylori Shi470 chromosome, complete genome
ATGAAACTGAGAGCAAGTGTTTTAATCGGTGCGATAATTCTGTGCTTAACTTTAAGCGCGTGCAGTAATT
ATGCGAAAAAAGTGGTGAAACAAAAGAACCATGTTTATACGCCTGTGTATAATGAATTGATAGAGAAGTA
TAGTGAGATACCCTTAAATGACAAACTCAAAGACACACCATTCATGGTGCAAGTGAAGTTGCCAAATTAC
AAGGACTATTTGTTGGATAATAAACAAGTTGTATTAACTTTCAAACTTGTTCATCATTCTAAAAAGATTA
CGCTCATAGGCGATGCCAATAAGATACTCCAATACAAGAATTACTTCCAAGCTAATGGAGCGAGATCCGA
TATTGATTTTTACTTGCAGCCTACTTTGAATCAAAAGGGTGTGGTGATGATAGCGAGTAACTATAATGAT
AATCCTAACAACAAAGAACAACCACAGACTTTTGATGTGTTGCAAGGAAGTCAGCCAATGCTAGGAGCTA
ACACAAAAAACTTGCATGGCTATGATGTGAGTGGAGCAAACAACAAGCAAGTGATCAATGAAGTGGCAAG
AGAAAAAGCTCAGCTAGAAAAAATCAATCAGTATTACAAAACGCTCTTACAAGACAAGGAACAAGAATAC
ACCACTAGAAAAAATAACCAACGAGAAATTTTAGAAACATTGAGTAATCGTGCAGGTTACCAAATGAGAC
AGAATGTGATTAGTTCTGAGATTTTTAAGAATGGCAACTTGAACATGCAATCCAAAGAAGAAGAAGTTAG
GGAGAAGCTACAAGAAGAAAGAGAGAATGAATACTTGCGCAATCAAATCAGAAGTTTGCTCAGTGGTAAG
TGA
 Primer design