SecReT4
Protein ID: 188527631
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04265
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]827737..828384 [-]
Productcag pathogenicity island protein CagU
Component typeCagU
UniProt IDB2UTV6
KEGG IDhps:HPSH_04265
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 215 a.a.     [Download]
>gi|188527631|ref|YP_001910318.1| cag pathogenicity island protein CagU [Helicobacter pylori Shi470]
MNDTTEHHGSNSLNAPSPSNSQSNDLLNLLDSLYPKGSLGEQRFHEALKNQEELKNILIEIEKLPQEKRY
ELLMQIGQAKQRIMEAYAHSFLGYIGGLEHLLGLCMGGIFVLFAIYFVFLRTSKNTDLVESLKTKLKLQY
FYYAFGVGAVLFFGLETIRSVYELYILGIGSTNDKVLFVLKNICFIGMGYLIYKVIKVIGIKNFINGLFT
SKKQE
 
Nucleotide Sequence: 648 bp     [Download]
>gi|209406223|ref|NC_010698.2|:c828384-827737 Helicobacter pylori Shi470 chromosome, complete genome
ATGAATGATACAACAGAGCACCATGGATCCAATTCGCTAAACGCCCCATCACCTAGCAACTCACAGAGCA
ATGATCTTTTAAATTTGCTAGACTCGTTATATCCCAAAGGGAGTTTAGGGGAGCAAAGATTTCACGAAGC
TCTAAAGAATCAAGAAGAGTTGAAAAATATCCTAATAGAAATAGAAAAGCTACCGCAAGAAAAAAGGTAT
GAACTTCTGATGCAGATAGGACAAGCCAAACAGAGAATAATGGAAGCATACGCTCATTCATTCTTGGGAT
ATATAGGTGGACTAGAGCATCTGTTAGGATTATGTATGGGTGGGATATTTGTTTTGTTTGCAATCTATTT
TGTATTTTTAAGAACTAGCAAAAACACGGATCTGGTGGAAAGTCTAAAAACAAAACTAAAACTTCAGTAT
TTTTACTATGCCTTTGGTGTGGGTGCGGTTTTGTTTTTTGGATTAGAAACAATTAGATCTGTTTATGAAC
TATATATATTAGGAATTGGTAGCACTAACGATAAGGTACTTTTTGTCTTGAAAAACATTTGCTTCATAGG
TATGGGCTATTTGATCTATAAAGTTATTAAGGTTATTGGTATAAAAAATTTTATCAATGGTCTTTTCACT
TCAAAGAAACAAGAATAA
 Primer design