SecReT4
Protein ID: 188527632
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04270
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]828660..829418 [+]
Productcag pathogenicity island protein CagV
Component typeCagV
UniProt IDB2UTV7
KEGG IDhps:HPSH_04270
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.2e-20, Aligned region: 23..225
Protein Sequence: 252 a.a.     [Download]
>gi|188527632|ref|YP_001910319.1| cag pathogenicity island protein CagV [Helicobacter pylori Shi470]
MLGKKNEEVLIDENLVGGVIALDRLAKLNKANRTFKRAFYLSMALNIAAVTSIVMMMPLKKTDIFVYGID
RYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQLMQYCDVSFQTQAMRMFNENI
RQFVDKVRAEAIISSNIRREKVKNSPLTRLTFFITIKITPDTMENYEYITKKEVTIYYDFARGNSSQENL
IINPFGFKVFDIQITDLQNEQTVSEILRKIKEVESKNKALKK
 
Nucleotide Sequence: 759 bp     [Download]
>gi|209406223|ref|NC_010698.2|:828660-829418 Helicobacter pylori Shi470 chromosome, complete genome
ATGTTAGGGAAAAAAAACGAGGAAGTCTTGATTGATGAAAATTTAGTTGGGGGTGTGATAGCCCTTGATA
GATTGGCAAAACTCAATAAAGCCAATAGGACTTTCAAAAGGGCTTTTTATCTCTCTATGGCACTCAATAT
CGCTGCTGTAACGAGTATTGTGATGATGATGCCTTTGAAGAAAACAGATATATTTGTTTATGGCATTGAT
CGATATACAGGAGAATTTAAAATTGTCAAACGCTCCGATGCTAGGCAAATTGTCAATTCTGAAGCTGTTG
TGGATAGCGCAACTTCAAAATTTGTTTCATTGCTGTTTGGTTATAGCAAAAATTCTTTGAGGGATCGCAA
GGATCAACTAATGCAGTATTGCGATGTGAGTTTCCAAACCCAAGCAATGAGAATGTTCAATGAAAATATC
AGACAATTTGTAGATAAAGTCCGAGCAGAAGCTATCATTAGCTCCAACATACGAAGAGAAAAAGTCAAAA
ATAGTCCCTTAACGAGATTAACATTTTTCATTACCATTAAAATCACACCTGATACAATGGAAAATTATGA
ATATATTACTAAAAAAGAAGTAACTATTTATTATGATTTTGCCAGAGGTAACTCTTCTCAAGAAAATCTT
ATCATCAATCCTTTTGGTTTCAAAGTGTTTGACATTCAAATCACAGATTTACAAAACGAACAGACGGTAA
GCGAAATTTTGAGAAAGATTAAAGAAGTGGAATCAAAAAATAAGGCATTAAAGAAATAA
 Primer design