SecReT4
Protein ID: 188527633
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04275
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]829423..831030 [+]
Productcag pathogenicity island protein CagW
Component typeCagW
UniProt IDB2UTV8
KEGG IDhps:HPSH_04275
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 535 a.a.     [Download]
>gi|188527633|ref|YP_001910320.1| cag pathogenicity island protein CagW [Helicobacter pylori Shi470]
MFNIKRIFLITIISFFLIVPNWLKAIDLPIVSNLKIYQTVYCMLIPSYVLTNKSFADILTGYTSIGASGS
GKSSGQGVIEALSAPLATSLAASNLVKYLNTLGPLWGSAWASVATAIQGFALTPSSGCNFGWNALINKNI
DVSTDSMLDNLSNKIRNFTKGGVEDNVKGNVLLQIIGSITAQVSTNITANSLIWLIGKEFTANKLQNNTT
AMLAFAALESIVKGADATVLPAYSVVNLPDIIIGQGSYLDFVSYLIYIVFGIFVFISFMKLRDISNGIQI
NIGFEYMRFVGGTLFKMAMVSFIAYAGFGYLYKISYSIYFGLAGAFGLNQTLFWALDLVLNYTVNSILPA
VRAVFSNVGNNAPSLLQGLQVAGISLFAIFMQVTIIMRISTVVVKPLIAGAFSGIVFPIAVCLIVLDWFK
DSMKNILIWFINNLFILVLAIPILLFGVLALLAFNLTITPSVAIQNINQGGLGIDSTIASLITLFILKGF
IETIIESVNAIVNTIFSSVSMDGSRMDRERDALMVGKVGGSMFKG
 
Nucleotide Sequence: 1608 bp     [Download]
>gi|209406223|ref|NC_010698.2|:829423-831030 Helicobacter pylori Shi470 chromosome, complete genome
ATGTTTAATATCAAAAGGATTTTTTTAATAACGATCATAAGTTTTTTTCTCATTGTTCCTAATTGGTTGA
AAGCTATTGATTTGCCCATTGTTTCAAATCTCAAAATTTACCAAACAGTTTATTGCATGCTGATACCGAG
TTATGTTTTAACCAACAAAAGTTTTGCAGATATTTTGACAGGTTATACATCTATTGGTGCGTCAGGGAGT
GGAAAGAGTTCAGGGCAGGGTGTGATCGAAGCGCTTAGTGCACCATTAGCTACAAGTTTAGCCGCTAGCA
ATCTAGTGAAATATTTGAATACTTTAGGTCCTTTATGGGGATCGGCGTGGGCAAGTGTTGCTACAGCTAT
ACAAGGTTTTGCTCTAACCCCATCAAGTGGTTGCAATTTTGGTTGGAACGCATTGATAAATAAAAACATA
GATGTATCCACAGATAGCATGCTAGACAATTTGAGCAACAAGATTCGGAATTTTACCAAAGGCGGTGTTG
AGGACAATGTGAAAGGCAATGTTCTTTTACAAATAATTGGCTCAATAACCGCTCAAGTTTCTACGAATAT
TACAGCTAATAGTTTAATTTGGCTGATTGGCAAAGAATTCACTGCAAATAAACTGCAAAACAACACTACA
GCCATGCTTGCTTTTGCCGCACTAGAATCTATTGTCAAAGGAGCGGACGCTACTGTTCTTCCTGCATATA
GTGTAGTCAATCTGCCTGATATTATCATAGGGCAAGGGTCATATCTTGATTTTGTTTCTTACCTAATTTA
TATTGTTTTTGGGATTTTTGTTTTTATTTCTTTTATGAAATTGAGAGATATTTCAAATGGCATTCAGATT
AACATAGGTTTTGAATACATGCGATTTGTTGGGGGGACATTATTCAAAATGGCGATGGTATCTTTTATCG
CCTATGCAGGTTTTGGTTATCTTTATAAAATCTCTTATTCCATTTATTTTGGTTTAGCAGGCGCTTTTGG
GCTGAATCAAACTCTTTTTTGGGCTTTAGATTTAGTGCTGAATTACACTGTTAATTCAATTTTACCTGCG
GTAAGAGCTGTTTTTTCTAATGTTGGCAACAACGCTCCTAGTTTGTTACAAGGCTTGCAAGTTGCAGGTA
TTTCTTTATTCGCTATTTTTATGCAAGTAACTATCATTATGAGAATAAGCACTGTTGTTGTGAAACCTTT
GATAGCGGGGGCTTTTAGCGGTATTGTGTTCCCTATTGCGGTATGTTTGATCGTGCTAGATTGGTTCAAA
GATTCTATGAAAAACATATTGATATGGTTTATTAATAATTTGTTTATCTTGGTTCTAGCTATTCCTATTT
TGCTCTTTGGTGTTTTGGCATTATTGGCATTCAATTTGACCATAACGCCCTCTGTTGCTATACAAAACAT
CAATCAAGGGGGACTGGGTATCGATTCGACTATTGCGAGTTTGATCACTTTATTTATTTTAAAAGGTTTC
ATAGAGACGATTATTGAGAGTGTCAATGCGATCGTTAATACCATTTTCAGTTCTGTCTCTATGGATGGTA
GCAGAATGGATAGGGAACGAGATGCCTTAATGGTAGGAAAAGTTGGTGGATCTATGTTTAAAGGATAA
 Primer design