SecReT4
Protein ID: 188527634
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04280
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]831082..832650 [+]
Productcag pathogenicity island protein CagX
Component typeCagX
UniProt IDB2UTV9
KEGG IDhps:HPSH_04280
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1e-37, Aligned region: 55..171
CagX [PF03524], Evalue: 1e-37, Aligned region: 260..347
CagX [PF03524], Evalue: 1e-37, Aligned region: 368..490
Protein Sequence: 522 a.a.     [Download]
>gi|188527634|ref|YP_001910321.1| cag pathogenicity island protein CagX [Helicobacter pylori Shi470]
MEQAFFKKIVGCFCLGYLFLSSVIEAAAPDIKNFNRGRVKVVNKKIAYLGDEKPITIWTSLDNVTVIQLE
KDETISYITTGFNKGWSIVPNSNHIFIQPKSVKSNLMFEKEAVNFALMTRDYQEFLKTKKLIVDAPDPKE
LEEQKKALEKEKEAKEQAQKAQKDKREKRKEERAKNRANLENLTNAMSNPQNLSNNKNLSEFIKQQRENE
LDQMERLEDMQEQAQANALKQIEELNKKQAEETIKQRAKNKINIKTDKPQKSPEDNSIELSPSDSAWRTN
LVVRTNKALYQFILRIAQKDNFASAYLTVKLEYPQRHEVSSVIEGELKKREEAKRQRELIKQENLNTTAY
INRVMMASNEQIINKEKIREEKQKIILDQAKALETQYVHNALKRNPVPRNYNYYQAPEKRSKHIMPSEIF
DDGTFTYFGFKNITLQPAIFVVQPDGKLSMTDAAIDPNMTNSGLRWYRVNEIAEKFKLIKDKALVTVINK
GYGKNPLTKNYNIKNYGELERVIKKLPLVRDK
 
Nucleotide Sequence: 1569 bp     [Download]
>gi|209406223|ref|NC_010698.2|:831082-832650 Helicobacter pylori Shi470 chromosome, complete genome
ATGGAGCAGGCATTTTTTAAAAAAATTGTTGGCTGTTTCTGTCTTGGTTATTTATTTTTATCTAGCGTAA
TAGAAGCAGCAGCACCTGACATTAAAAATTTTAATCGTGGTAGGGTGAAAGTGGTGAATAAGAAGATTGC
TTATTTAGGAGATGAAAAACCTATTACGATTTGGACTTCATTAGACAATGTTACTGTGATCCAACTTGAA
AAAGATGAAACCATTTCTTACATCACAACAGGTTTCAATAAAGGTTGGAGTATTGTGCCTAATTCTAATC
ATATATTCATTCAACCTAAATCGGTAAAAAGTAATCTCATGTTTGAAAAAGAAGCAGTGAATTTTGCTCT
AATGACAAGAGATTACCAAGAATTTTTAAAAACAAAAAAACTTATCGTAGATGCACCTGACCCTAAAGAA
TTAGAAGAACAAAAAAAAGCTCTAGAAAAAGAAAAAGAAGCTAAAGAACAGGCGCAAAAAGCGCAAAAAG
ATAAAAGAGAAAAAAGAAAGGAAGAGCGTGCAAAAAATAGAGCCAATTTAGAAAATCTCACTAACGCTAT
GAGTAACCCACAAAATTTGAGCAATAACAAAAATCTTAGCGAATTTATCAAGCAACAACGAGAAAATGAA
TTAGACCAAATGGAACGACTAGAGGACATGCAAGAACAGGCTCAAGCTAATGCACTCAAACAAATTGAAG
AACTCAACAAGAAACAAGCTGAAGAGACAATAAAACAAAGAGCCAAGAATAAAATCAATATTAAGACAGA
TAAGCCTCAAAAAAGCCCTGAGGATAACTCCATAGAATTATCTCCTAGCGATAGCGCTTGGAGAACTAAT
CTTGTTGTGCGGACCAATAAGGCCTTGTATCAATTCATTTTGAGAATAGCTCAAAAAGACAATTTTGCTT
CGGCGTATCTAACAGTCAAATTAGAATACCCACAAAGACACGAAGTCTCTAGCGTTATTGAAGGGGAGCT
AAAAAAGAGAGAAGAAGCAAAGAGGCAGAGAGAATTGATTAAGCAAGAAAATCTTAACACCACAGCCTAC
ATCAATAGAGTAATGATGGCGAGCAACGAACAGATTATCAACAAAGAAAAAATAAGAGAAGAAAAACAAA
AAATTATCTTAGATCAAGCAAAGGCGCTAGAGACTCAATATGTGCATAATGCATTAAAAAGAAACCCTGT
GCCTAGAAACTACAATTACTACCAAGCACCTGAAAAACGCTCTAAACATATTATGCCCTCTGAAATTTTT
GATGATGGCACATTCACTTATTTTGGTTTCAAAAACATCACCCTCCAACCTGCTATTTTTGTGGTTCAGC
CTGATGGGAAATTAAGCATGACTGATGCCGCTATTGATCCTAACATGACCAATTCAGGATTGAGATGGTA
TAGAGTTAATGAAATTGCAGAAAAGTTTAAGCTCATTAAAGACAAAGCCCTTGTAACAGTAATAAATAAA
GGCTATGGGAAAAATCCATTGACAAAAAATTACAATATCAAAAACTATGGTGAATTGGAGCGTGTGATTA
AAAAGCTCCCTCTTGTCAGAGATAAATAA
 Primer design