SecReT4
Protein ID: 188527635
T4SS name [ID]Cag [36]
Gene symbol-
Locus tagHPSH_04285
StrainHelicobacter pylori Shi470
Repliconchromosome [GenBank: NC_010698] [Browse all T4SS(s) in this replicon]
Location [Strand]832665..838229 [+]
Productcag pathogenicity island protein CagY
Component typeCagY
UniProt IDB2UTW0
KEGG IDhps:HPSH_04285
PDB IDNA
Domain hit(s) vs Pfam CagY_M [PF07337], Evalue: 0, Aligned region: 435..461
CagY_M [PF07337], Evalue: 0, Aligned region: 469..496
CagY_M [PF07337], Evalue: 0, Aligned region: 506..534
CagY_M [PF07337], Evalue: 0, Aligned region: 548..580
CagY_M [PF07337], Evalue: 0, Aligned region: 581..611
CagY_M [PF07337], Evalue: 0, Aligned region: 617..649
CagY_M [PF07337], Evalue: 0, Aligned region: 651..674
CagY_M [PF07337], Evalue: 0, Aligned region: 686..718
CagY_M [PF07337], Evalue: 0, Aligned region: 725..757
CagY_M [PF07337], Evalue: 0, Aligned region: 763..795
CagY_M [PF07337], Evalue: 0, Aligned region: 796..824
CagY_M [PF07337], Evalue: 0, Aligned region: 832..864
CagY_M [PF07337], Evalue: 0, Aligned region: 870..902
CagY_M [PF07337], Evalue: 0, Aligned region: 909..941
CagY_M [PF07337], Evalue: 0, Aligned region: 947..979
CagY_M [PF07337], Evalue: 0, Aligned region: 980..1008
CagY_M [PF07337], Evalue: 0, Aligned region: 1016..1048
CagY_M [PF07337], Evalue: 0, Aligned region: 1054..1086
CagY_M [PF07337], Evalue: 0, Aligned region: 1092..1124
CagY_M [PF07337], Evalue: 0, Aligned region: 1130..1162
CagY_M [PF07337], Evalue: 0, Aligned region: 1169..1200
CagY_M [PF07337], Evalue: 0, Aligned region: 1202..1230
CagY_M [PF07337], Evalue: 0, Aligned region: 1238..1270
CagY_M [PF07337], Evalue: 0, Aligned region: 1277..1308
CagY_M [PF07337], Evalue: 0, Aligned region: 1316..1350
CagY_M [PF07337], Evalue: 0, Aligned region: 1355..1382
CagY_M [PF07337], Evalue: 0, Aligned region: 1404..1438
TrbI [PF03743], Evalue: 6.6e-36, Aligned region: 1618..1814
Protein Sequence: 1854 a.a.     [Download]
>gi|188527635|ref|YP_001910322.1| cag pathogenicity island protein CagY [Helicobacter pylori Shi470]
MNEENDKLETSKKTQQHSPQDLSNEETIKANHFEDSSKESKESSNHHLDNSTETKTNFDEYKSEETQTQM
DSGGNETSESSNLADKLFKKARKLVDNKRPFTQQKNLDEEIQEPNEEDDQENNGYQEEIQMDLIDDETSK
KTQQHSPQDLSNEETIKANHFEDSSEESKENSDHHLDNSTETKTNFDGEKSEETQTQMDSGGNETSESSN
LADKLFKKARKLVDNKRPFTQQKNLDEEIQEPNEEDDQENNGYQEEIQMDLIDDETSKKTQQHSPQDLSN
EETIKANHFEDSSKESKENSDHHLDNSTETKTNFDGEKSEEITNDSNDQEIIKGSKKKYIIGGIVVAVLI
VIILFSRSIFHYFIPLEDKSSRFSKDRNLYVNDEIQIRQEYNRLLKERNEKGNMIDKNLFFNDDPNRTLY
NYLNIAEIEDKNPLRAFYECISNGGNYEECLKLIKDKKLQDQMKKTLEAYNDCIKNAKTEEERIKCLDLI
KDENLKKSLLNQQKVQVALDCLKNAKTDEERNECLKLINDPEIREKFRKELELQKELQEYKDCIKNAKTE
AEKNECLKGLSKEAIERLKQQALDCLKNAKTDEERKKCLKNIPQDLQKELLADMSVKAYKDCVSKARNEK
EKKECEKLLTPEAKKKLEQQVLDCLKNAKTDEERKKCLKDLPKDLQSDILAKESVKAYKDCVSQARTEAE
KKECEKLLTPEAKKLLEEEAKESVKAYLDCVSQAKTEAEKKECEKLLTPEAKKKLEEAKKSVKAYLDCVS
QAKTEAEKKECEKLLTPEARKLLEQQALDCLKNAKTEAEKKRCVKDLPKDLQKKVLAKESVKAYLDCVSQ
AKTEAEKKECEKLLTPEAKKLLEEAKESLKAYKDCVSQARTEAEKKECEKLLTPEAKKLLEEEAKESVKA
YLDCVSRARNEKEKQECEKLLTPEARKKLEEAKKSVKAYLDCVSQAKTEAEKKECEKLLTPEAKKLLEQQ
ALDCLKNAKTEAEKKRCVKDLPKDLQKKVLAKESLKAYKDCVSRARNEKEKKECEKLLTPEAKKLLEEAK
ESLKAYKDCVSRARNEKEKKECEKLLTPEARKLLEEAKKSVKAYLDCVSRARNEKEKKECEKLLTPEARK
LLEEAKESLKAYKDCLSQARNEEERKACEKLLTPEARKLLEQEVKKSVKAYLDCVSRARNEKEKQECEKL
LTPEARKFLAKQALSCLEKARNEEERKACLKNIPKDLQKNVLAKESLKAYKDCLSQARNEEERKACEKLL
TPEARKLLEQEVKNSVKAYLDCVSRARNEKEKQECEKLLTPEARKFLAKELQQKDKAIKDCLKNADPNDR
AAIMKCLDGLSDEEKLKYLQEAREKAVLDCLKTAKTDEEKRKCQNLYSDLIQEIQNKRAQSKQNQLSKTE
RLHQASECLDNLDDPTDQEAIEQCLEGLSDSERALILGIKRQADEVDLIYSDLRNRKTFDNMAAKGYPLL
PMDFKNGGDIATINATNVDADKIASDNPIYASIEPDITKQYETEKTIKDKNLEAKLAKALGGNKKDDDKE
KSKKSTAEARVESNKIDKDVAETAKNISEIALKNKKEKSGEFVDENGNPIDDKKKTEKQDETSPVKQAFI
GKSDPTFVLAQYTPIEITLTSKVDATLTGIVSGVVAKDVWNMNGTMILLDKGTKVYGNYQSVKGGTPIMT
RLMIVFTKAITPDGVIIPLANAQAAGMLGEAGVDGYVNNHFMKRIGFAVVASVVNSFLQTAPIIALDKLI
GLGKGRSERTPEFNYALGQAINGSMQSSAQMSNQILGQLMNIPPSFYKNEGDSIKILTMDDIDFSGVYDV
KITNKSVVDEIIKQSTKTLSREHEEITTSPKGGN
 
Nucleotide Sequence: 5565 bp     [Download]
>gi|209406223|ref|NC_010698.2|:832665-838229 Helicobacter pylori Shi470 chromosome, complete genome
ATGAATGAAGAAAACGATAAACTTGAAACTTCTAAAAAAACCCAACAACATTCACCCCAAGATTTATCCA
ATGAAGAAACAATAAAAGCCAATCACTTTGAAGATTCTTCAAAAGAATCCAAAGAAAGCTCAAATCATCA
TCTTGACAACTCCACAGAAACTAAAACCAATTTTGATGAATACAAGTCAGAAGAAACCCAAACTCAAATG
GATTCTGGAGGTAATGAAACTTCAGAATCTAGCAATCTAGCAGACAAGTTATTCAAAAAAGCCAGAAAAT
TAGTTGATAATAAAAGACCTTTCACTCAGCAAAAGAATTTAGATGAAGAAATCCAAGAACCGAACGAAGA
AGACGATCAAGAAAATAATGGGTATCAAGAAGAAATTCAAATGGATTTAATTGATGATGAAACTTCTAAA
AAAACCCAACAACATTCACCCCAAGATCTATCCAATGAAGAAACAATAAAAGCCAATCACTTTGAAGATT
CTTCAGAAGAATCCAAAGAAAACTCAGATCATCATCTTGACAACTCCACAGAAACTAAAACCAATTTTGA
TGGAGAAAAGTCAGAAGAAACCCAAACTCAAATGGATTCTGGAGGTAATGAAACTTCAGAATCTAGCAAT
CTAGCAGACAAGTTATTCAAAAAAGCCAGAAAATTAGTTGATAATAAAAGACCTTTCACTCAGCAAAAGA
ATTTAGATGAAGAAATCCAAGAACCGAACGAAGAAGACGATCAAGAAAATAATGGGTATCAAGAAGAAAT
TCAAATGGATTTAATTGATGATGAAACTTCTAAAAAAACCCAACAACATTCACCCCAAGATCTATCCAAT
GAAGAAACAATAAAAGCCAATCACTTTGAAGATTCTTCAAAAGAATCCAAAGAAAACTCAGATCATCATC
TTGACAACTCCACAGAAACTAAAACCAATTTTGATGGAGAAAAGTCAGAAGAAATAACTAACGATTCTAA
CGATCAAGAGATTATCAAAGGAAGCAAAAAGAAATACATTATTGGTGGCATTGTAGTCGCTGTTCTTATC
GTGATTATTTTATTTTCTAGAAGCATTTTTCACTATTTCATACCTTTGGAAGATAAAAGCTCTCGTTTTA
GCAAAGACAGGAATCTTTATGTCAATGATGAAATCCAAATAAGGCAAGAGTATAACCGATTGCTGAAAGA
ACGGAATGAAAAAGGCAATATGATCGATAAGAATCTTTTCTTCAATGACGATCCCAATAGAACCTTATAC
AACTATTTGAATATTGCAGAAATTGAGGACAAAAACCCATTGAGAGCCTTTTATGAATGTATTAGTAATG
GTGGTAACTATGAAGAATGTTTGAAGCTTATCAAAGACAAAAAACTTCAAGATCAAATGAAAAAGACTTT
AGAGGCTTATAATGACTGCATCAAAAATGCCAAAACTGAAGAAGAAAGGATCAAGTGTTTAGATTTAATC
AAAGATGAAAACCTGAAAAAAAGCTTACTGAACCAACAAAAAGTTCAAGTGGCACTAGATTGTTTGAAAA
ACGCTAAAACCGATGAAGAACGAAACGAGTGCCTAAAACTCATAAATGACCCTGAGATTAGAGAGAAATT
CCGTAAGGAATTAGAGCTTCAAAAAGAGCTTCAAGAGTATAAGGATTGTATCAAAAACGCCAAAACAGAA
GCTGAGAAAAACGAATGCTTGAAAGGCTTGTCTAAGGAAGCTATAGAAAGATTGAAACAGCAAGCGCTAG
ATTGTTTGAAAAACGCTAAAACCGATGAAGAACGAAAAAAGTGTTTGAAAAATATTCCCCAAGACTTGCA
AAAAGAACTACTAGCTGATATGAGCGTCAAGGCTTACAAGGATTGCGTATCAAAAGCTAGGAATGAAAAA
GAGAAAAAAGAATGCGAGAAATTACTCACGCCTGAAGCGAAAAAAAAGTTAGAACAACAGGTTCTAGATT
GTTTGAAAAACGCTAAAACCGATGAAGAACGAAAAAAGTGTTTGAAAGATCTCCCTAAAGACTTACAAAG
CGATATTTTAGCTAAAGAGAGCGTTAAAGCTTATAAAGACTGCGTATCTCAAGCCAGAACTGAAGCTGAG
AAAAAAGAATGCGAGAAATTACTCACGCCTGAAGCGAAAAAACTTTTAGAAGAAGAAGCCAAAGAGAGCG
TTAAAGCTTATTTGGATTGCGTATCTCAAGCCAAAACTGAAGCTGAGAAAAAAGAATGCGAGAAATTACT
CACGCCTGAAGCGAAAAAAAAGTTAGAAGAAGCTAAAAAAAGCGTTAAGGCTTACCTGGATTGCGTATCT
CAAGCCAAAACTGAAGCTGAGAAAAAAGAATGCGAGAAATTACTCACCCCTGAAGCGAGAAAGCTTTTAG
AGCAACAAGCGCTAGATTGTTTGAAAAACGCTAAAACCGAAGCTGAGAAAAAAAGGTGTGTCAAAGATCT
CCCTAAAGACTTGCAGAAAAAGGTTTTAGCTAAAGAGAGCGTTAAGGCTTATTTGGATTGCGTATCTCAA
GCCAAAACTGAAGCTGAGAAAAAAGAATGCGAAAAATTACTCACCCCTGAAGCGAAAAAACTTTTAGAAG
AAGCTAAAGAGAGTCTTAAAGCTTATAAAGACTGCGTATCTCAAGCCAGAACTGAAGCTGAGAAAAAAGA
ATGCGAGAAATTACTCACGCCTGAAGCGAAAAAACTTTTAGAAGAAGAAGCTAAAGAGAGCGTTAAGGCT
TATTTGGACTGCGTTTCAAGAGCTAGGAATGAAAAAGAGAAACAAGAATGCGAGAAATTGCTCACCCCTG
AAGCGAGAAAAAAGTTAGAAGAAGCTAAAAAAAGCGTTAAGGCTTACCTGGATTGCGTATCTCAAGCCAA
AACTGAAGCTGAGAAAAAAGAATGCGAGAAATTACTCACGCCTGAAGCGAAAAAACTTTTAGAACAACAA
GCGCTAGATTGTTTGAAAAACGCTAAAACCGAAGCTGAGAAAAAAAGGTGCGTCAAAGATCTTCCTAAAG
ACTTGCAGAAAAAGGTTTTAGCCAAAGAGAGTCTTAAGGCTTATAAAGACTGTGTTTCAAGAGCTAGGAA
TGAAAAAGAGAAAAAAGAATGCGAGAAATTACTCACGCCTGAAGCGAAAAAACTTTTAGAAGAAGCTAAA
GAGAGTCTTAAAGCTTATAAAGACTGCGTTTCAAGAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGA
AATTACTCACCCCTGAAGCGAGAAAACTTTTAGAAGAAGCTAAAAAAAGCGTTAAGGCTTATTTGGACTG
CGTTTCAAGAGCTAGGAATGAAAAAGAGAAAAAAGAATGCGAGAAATTACTCACCCCTGAAGCGAGAAAA
CTTTTAGAAGAAGCTAAAGAGAGTCTTAAAGCTTATAAAGACTGCCTCTCTCAAGCTAGAAATGAAGAAG
AAAGAAAAGCTTGTGAGAAATTGCTCACGCCTGAAGCGAGAAAACTCTTAGAGCAAGAAGTTAAGAAGAG
CGTTAAGGCTTATTTGGACTGCGTTTCAAGAGCTAGGAATGAAAAAGAGAAACAAGAATGCGAGAAATTG
CTCACCCCTGAAGCGAGAAAATTTTTAGCGAAGCAAGCGCTAAGTTGTTTGGAAAAAGCTAGAAATGAAG
AAGAAAGAAAAGCATGTCTTAAAAATATCCCTAAAGACTTACAGAAAAATGTTTTAGCTAAAGAGAGTCT
TAAAGCTTATAAAGACTGCCTCTCTCAAGCTAGAAATGAAGAAGAAAGAAAAGCTTGTGAGAAATTGCTC
ACCCCTGAAGCGAGAAAACTCTTAGAGCAAGAAGTTAAGAATAGCGTTAAGGCTTATTTGGACTGCGTTT
CAAGAGCTAGGAATGAAAAAGAGAAACAAGAATGCGAGAAATTGCTCACCCCTGAAGCGAGAAAATTTTT
AGCGAAAGAGCTCCAACAAAAAGATAAAGCGATCAAAGATTGCTTGAAAAACGCCGATCCTAACGACAGA
GCAGCTATTATGAAGTGTTTGGATGGTTTGAGCGATGAAGAGAAGCTCAAATACCTGCAAGAAGCTAGAG
AAAAGGCTGTCTTGGATTGTTTGAAAACGGCTAAGACCGATGAAGAAAAAAGGAAATGTCAAAACCTTTA
TAGCGATTTGATCCAAGAAATCCAAAATAAAAGGGCACAAAGCAAACAAAATCAATTGAGTAAAACAGAA
AGATTGCATCAAGCAAGCGAGTGCTTGGATAACTTAGATGACCCTACTGATCAAGAAGCCATAGAGCAAT
GTTTAGAAGGCTTGAGCGATAGTGAAAGGGCGCTAATTCTAGGAATTAAACGACAAGCTGATGAAGTGGA
TCTGATTTATAGCGATCTAAGAAACCGCAAAACCTTTGATAACATGGCGGCTAAAGGTTATCCATTGTTG
CCAATGGATTTCAAAAATGGTGGCGATATTGCCACTATTAACGCCACTAATGTTGATGCGGACAAAATAG
CTAGCGATAATCCTATTTATGCTTCCATAGAGCCTGACATTACTAAGCAATACGAAACAGAAAAAACCAT
TAAGGATAAGAATTTAGAAGCTAAATTAGCTAAGGCTTTAGGTGGCAATAAAAAAGATGACGATAAAGAA
AAAAGTAAAAAATCCACAGCAGAAGCTAGAGTAGAAAGCAATAAGATAGACAAAGATGTCGCAGAAACTG
CCAAAAATATCAGTGAAATCGCTCTTAAGAACAAAAAAGAAAAGAGTGGGGAATTTGTAGATGAAAATGG
TAATCCCATTGATGACAAAAAGAAAACAGAAAAACAAGATGAAACAAGCCCTGTCAAACAGGCCTTTATA
GGCAAGAGTGATCCCACATTTGTTTTAGCGCAATACACCCCTATTGAAATCACTCTGACTTCTAAAGTAG
ATGCCACTCTCACAGGTATAGTGAGTGGGGTTGTGGCCAAAGATGTATGGAACATGAACGGCACCATGAT
CTTACTAGACAAAGGCACTAAGGTGTATGGGAATTATCAAAGCGTGAAAGGTGGCACACCCATTATGACA
CGCTTAATGATAGTCTTCACTAAAGCCATTACGCCTGATGGTGTGATAATACCTCTAGCAAACGCTCAAG
CAGCAGGCATGCTGGGTGAAGCAGGGGTAGATGGCTATGTGAATAATCACTTTATGAAGCGCATAGGCTT
TGCTGTGGTAGCAAGCGTGGTTAATAGCTTCTTGCAAACTGCGCCTATCATAGCTCTAGATAAACTCATA
GGCCTTGGCAAAGGTAGAAGTGAAAGGACACCTGAATTTAATTACGCTTTGGGTCAAGCTATCAATGGTA
GTATGCAAAGTTCAGCTCAGATGTCTAATCAAATTCTAGGGCAACTGATGAATATCCCCCCAAGTTTTTA
CAAAAATGAGGGCGATAGTATTAAAATTCTCACAATGGACGATATTGATTTTAGTGGCGTATATGATGTT
AAAATTACCAACAAATCTGTGGTAGATGAAATTATCAAACAAAGCACTAAAACTTTGTCTAGAGAGCATG
AAGAAATCACCACAAGCCCCAAAGGTGGCAATTAA
 Primer design